Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PDE4ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PDE4A Polyclonal Antibody | anti-PDE4A antibody

PDE4A Antibody - middle region

Gene Names
PDE4A; PDE4; DPDE2; PDE46
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDE4A; Polyclonal Antibody; PDE4A Antibody - middle region; anti-PDE4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEEIS
Sequence Length
686
Applicable Applications for anti-PDE4A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDE4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDE4ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDE4ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDE4A antibody
The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-PDE4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75 kDa
NCBI Official Full Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 4A
NCBI Official Symbol
PDE4A
NCBI Official Synonym Symbols
PDE4; DPDE2; PDE46
NCBI Protein Information
cAMP-specific 3',5'-cyclic phosphodiesterase 4A
UniProt Protein Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4A
UniProt Gene Name
PDE4A
UniProt Synonym Gene Names
DPDE2
UniProt Entry Name
PDE4A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

PDE4A: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. Isoform 1 interacts with LYN. Isoform 2 and isoform 6 interact weakly with LYN. Isoform 1, isoform 2 and isoform 6 interact with ARRB2. Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchial smooth muscle. Isoform 6 is expressed at high levels in the heart and small intestine. It is also found in the brain, kidney, spleen, colon, salivary gland, ovary and peripheral blood lymphocytes. Isoform 7 is expressed predominantly in skeletal muscle and brain and at lower levels in the testis. Isoform 7 is expressed in the brain. Found in specific neuronal subpopulations in cortex, spinal cord and cerebellum. Isoform 1, isoform 2, isoform 6 and isoform 7 are inhibited by rolipram and cilomilast. Isoform 1, isoform 2 and isoform 6 are inhibited by 4-[(3-butoxy-4-methoxyphenyl)-methyl]- 2-imidazolidinone (Ro 20-1724), roflumilast and denbufylline. Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphodiesterase; EC 3.1.4.53; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: membrane; perinuclear region of cytoplasm; cytosol

Molecular Function: 3',5'-cyclic-AMP phosphodiesterase activity; protein binding; metal ion binding; cAMP binding

Biological Process: sensory perception of smell; cAMP catabolic process; signal transduction

Research Articles on PDE4A

Similar Products

Product Notes

The PDE4A pde4a (Catalog #AAA3223467) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE4A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE4A pde4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDNRDWYYSA IRQSPSPPPE EESRGPGHPP LPDKFQFELT LEEEEEEEIS. It is sometimes possible for the material contained within the vial of "PDE4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.