Rabbit anti-Human PDCL Polyclonal Antibody | anti-PDCL antibody

PDCL Polyclonal Antibody

Cat. Num. AAA9133748

• Gene Names: PDCL; PhLP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: PDCL; Polyclonal Antibody; PDCL Polyclonal Antibody; PhLP; anti-PDCL antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQL
• Sequence Length: 301

• Applicable Applications for anti-PDCL antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human PDCL
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Positive Samples: 293T, HepG2, OVCAR3
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PDCL antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Related Product Information for anti-PDCL antibody

Phosducin-like protein is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in retina and pineal gland. Both phosducin-like protein and phosphoducin have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.

Product Categories/Family for anti-PDCL antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 88758594
• NCBI GeneID: 5082
• NCBI Accession #: NP_005379.3
• NCBI GenBank Nucleotide #: NM_005388.4
• UniProt Accession #: Q13371; Q4VXB6; Q96AF1; Q9UEW7; Q9UFL0; Q9UNX1; Q9UNX2
• Molecular Weight: Calculated: 24kDa; 34kDa; Observed: 34kDa
• NCBI Official Full Name: phosducin-like protein
• NCBI Official Synonym Full Names: phosducin like
• NCBI Official Symbol: PDCL
• NCBI Official Synonym Symbols: PhLP
• NCBI Protein Information: phosducin-like protein
• UniProt Protein Name: Phosducin-like protein
• Protein Family: Phosducin-like protein
• UniProt Gene Name: PDCL
• UniProt Synonym Gene Names: PHLOP1; PhLP1; PHLP

NCBI Description

Phosducin-like protein is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin, a phosphoprotein expressed in retina and pineal gland. Both phosducin-like protein and phosphoducin have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

Isoform 1: Functions as a co-chaperone for CCT in the assembly of heterotrimeric G protein complexes, facilitates the assembly of both Gbeta-Ggamma and RGS-Gbeta5 heterodimers.