Immunohistochemistry (IHC)
(Human Liver )
Rabbit PCYOX1 Polyclonal Antibody | anti-PCYOX1 antibody
PCYOX1 antibody - C-terminal region
Gene Names
PCYOX1; PCL1
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PCYOX1; Polyclonal Antibody; PCYOX1 antibody - C-terminal region; anti-PCYOX1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY
Sequence Length
505
Applicable Applications for anti-PCYOX1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 83%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 83%; Rabbit: 100%; Yeast: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PCYOX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Liver )
Immunohistochemistry (IHC)
(Human Liver )
Immunohistochemistry (IHC)
(Rabbit Anti-PCYOX1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-PCYOX1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PCYOX1 antibody
This is a rabbit polyclonal antibody against PCYOX1. It was validated on Western Blot and immunohistochemistry
Target Description: Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.
Target Description: Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.
Product Categories/Family for anti-PCYOX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
prenylcysteine oxidase 1
NCBI Official Synonym Full Names
prenylcysteine oxidase 1
NCBI Official Symbol
PCYOX1
NCBI Official Synonym Symbols
PCL1
NCBI Protein Information
prenylcysteine oxidase 1
UniProt Protein Name
Prenylcysteine oxidase 1
Protein Family
UniProt Gene Name
PCYOX1
UniProt Synonym Gene Names
KIAA0908; PCL1
UniProt Entry Name
PCYOX_HUMAN
NCBI Description
Prenylcysteine is released during the degradation of prenylated proteins. PCYOX1 catalyzes the degradation of prenylcysteine to yield free cysteines and a hydrophobic isoprenoid product (Tschantz et al., 1999 [PubMed 10585463]).[supplied by OMIM, Mar 2008]
Research Articles on PCYOX1
Similar Products
Product Notes
The PCYOX1 pcyox1 (Catalog #AAA3201280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCYOX1 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PCYOX1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PCYOX1 pcyox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFSQETLTKA QILKLFLSYD YAVKKPWLAY PHYKPPEKCP SIILHDRLYY. It is sometimes possible for the material contained within the vial of "PCYOX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
