Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-DCT Polyclonal Antibody)

Rabbit anti-Human, Mouse DCT Polyclonal Antibody | anti-DCT antibody

DCT Polyclonal Antibody

Gene Names
DCT; TRP-2; TYRP2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DCT; Polyclonal Antibody; DCT Polyclonal Antibody; TRP-2; TYRP2; dopachrome tautomerase; anti-DCT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
6.99 mg/ml (varies by lot)
Sequence Length
552
Applicable Applications for anti-DCT antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-350 of human DCT (NP_001913.2).
Immunogen Sequence
NVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA
Positive Samples
MCF7, A-375, HeLa, Mouse Brain
Cellular Location
Melanosome Membrane, Single-Pass Type I Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-DCT Polyclonal Antibody)

Western Blot (WB) (Western blot-DCT Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 59kDa; 62kDa
Observed: 59kDa
NCBI Official Full Name
L-dopachrome tautomerase isoform 2
NCBI Official Synonym Full Names
dopachrome tautomerase
NCBI Official Symbol
DCT
NCBI Official Synonym Symbols
TRP-2; TYRP2
NCBI Protein Information
L-dopachrome tautomerase
UniProt Protein Name
L-dopachrome tautomerase
Protein Family
UniProt Gene Name
DCT
UniProt Synonym Gene Names
TYRP2; DCT; DT; TRP-2; TRP2
UniProt Entry Name
TYRP2_HUMAN

Uniprot Description

DCT: Involved in regulating eumelanin and phaeomelanin levels. Belongs to the tyrosinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Isomerase; EC 5.3.3.12; Membrane protein, integral; Amino Acid Metabolism - tyrosine; Cell development/differentiation

Chromosomal Location of Human Ortholog: 13q32

Cellular Component: melanosome membrane; integral to membrane; melanosome; cytosol

Molecular Function: copper ion binding; oxidoreductase activity; dopachrome isomerase activity

Biological Process: neuroblast division in the ventricular zone; positive regulation of neuroblast proliferation; epidermis development; pigmentation during development; melanin biosynthetic process from tyrosine; cell development

Research Articles on DCT

Similar Products

Product Notes

The DCT dct (Catalog #AAA9140685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCT Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DCT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DCT dct for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.