Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PCF11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Human, Mouse PCF11 Polyclonal Antibody | anti-PCF11 antibody
PCF11 Rabbit pAb
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
PCF11; Polyclonal Antibody; PCF11 Rabbit pAb; anti-PCF11 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV
Applicable Applications for anti-PCF11 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1256-1555 of human PCF11 (NP_056969.2).
Cellular Location
Nucleus
Positive Samples
LO2, Jurkat, HeLa, Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PCF11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PCF11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-PCF11 antibody
Background: The protein encoded by this gene binds to CLP1 to form pre-mRNA cleavage factor IIm. The encoded protein is necessary for efficient Pol II transcription termination and may be involved in degradation of the 3' product of polyA site cleavage.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
173,050 Da
NCBI Official Full Name
pre-mRNA cleavage complex 2 protein Pcf11 isoform 3
NCBI Official Synonym Full Names
PCF11 cleavage and polyadenylation factor subunit
NCBI Official Symbol
PCF11
NCBI Protein Information
pre-mRNA cleavage complex 2 protein Pcf11
UniProt Protein Name
Pre-mRNA cleavage complex 2 protein Pcf11
Protein Family
UniProt Gene Name
PCF11
UniProt Synonym Gene Names
KIAA0824
NCBI Description
The protein encoded by this gene binds to CLP1 to form pre-mRNA cleavage factor IIm. The encoded protein is necessary for efficient Pol II transcription termination and may be involved in degradation of the 3' product of polyA site cleavage. [provided by RefSeq, Oct 2016]
Uniprot Description
PCF11: Component of pre-mRNA cleavage complex II.
Protein type: RNA processing; RNA splicing
Chromosomal Location of Human Ortholog: 11q14.1
Cellular Component: cytoplasm; mitochondrion; mRNA cleavage factor complex; nucleoplasm
Molecular Function: mRNA binding
Biological Process: mRNA 3'-end processing; mRNA cleavage; mRNA polyadenylation; mRNA splicing, via spliceosome; termination of RNA polymerase II transcription
Research Articles on PCF11
Similar Products
Product Notes
The PCF11 pcf11 (Catalog #AAA9142349) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCF11 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PCF11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PCF11 pcf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PKAYPDNHLS QVDVNELFSK LLKTGILKLS QTDSATTQVS EVTAQPPPEE EEDQNEDQDV PDLTNFTVEE LKQRYDSVIN RLYTGIQCYS CGMRFTTSQT DVYADHLDWH YRQNRTEKDV SRKVTHRRWY YSLTDWIEFE EIADLEERAK SQFFEKVHEE VVLKTQEAAK EKEFQSVPAG PAGAVESCEI CQEQFEQYWD EEEEEWHLKN AIRVDGKIYH PSCYEDYQNT SSFDCTPSPS KTPVENPLNI MLNIVKNELQ EPCDSPKVKE ERIDTPPACT EESIATPSEI KTENDTVESV. It is sometimes possible for the material contained within the vial of "PCF11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
