Rabbit PCBP2 Polyclonal Antibody | anti-PCBP2 antibody

PCBP2 antibody - middle region

Cat. Num. AAA3205325

• Gene Names: PCBP2; HNRPE2; HNRNPE2; hnRNP-E2
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: PCBP2; Polyclonal Antibody; PCBP2 antibody - middle region; anti-PCBP2 antibody

• Host: Rabbit
• Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
• Sequence Length: 366

• Applicable Applications for anti-PCBP2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PCBP2 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: MouseTarget Name: PCBP2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PCBP2Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PCBP2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat)

Related Product Information for anti-PCBP2 antibody

This is a rabbit polyclonal antibody against PCBP2. It was validated on Western Blot and immunohistochemistry

Target Description: PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.

Product Categories/Family for anti-PCBP2 antibody

Polyclonal; RNA Binding Proteins; Drugs and Drug Metabolism; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 14141168
• NCBI GeneID: 5094
• NCBI Accession #: NP_005007
• NCBI GenBank Nucleotide #: NM_005016
• UniProt Accession #: Q6IPF4; Q15366
• Molecular Weight: 40kDa
• NCBI Official Full Name: poly(rC)-binding protein 2 isoform a
• NCBI Official Synonym Full Names: poly(rC) binding protein 2
• NCBI Official Symbol: PCBP2
• NCBI Official Synonym Symbols: HNRPE2; HNRNPE2; hnRNP-E2
• NCBI Protein Information: poly(rC)-binding protein 2
• Protein Family: Poly(rC)-binding protein

NCBI Description

The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018]