Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-INADL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)

Rabbit PATJ Polyclonal Antibody | anti-PATJ antibody

PATJ Antibody - N-terminal region

Gene Names
PATJ; Cipp; INADL; hINADL; InaD-like
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PATJ; Polyclonal Antibody; PATJ Antibody - N-terminal region; anti-PATJ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG
Sequence Length
1801
Applicable Applications for anti-PATJ antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human INADL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-INADL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-INADL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Related Product Information for anti-PATJ antibody
This is a rabbit polyclonal antibody against INADL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.
Product Categories/Family for anti-PATJ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
196kDa
NCBI Official Full Name
inaD-like protein isoform 1
NCBI Official Synonym Full Names
PATJ crumbs cell polarity complex component
NCBI Official Symbol
PATJ
NCBI Official Synonym Symbols
Cipp; INADL; hINADL; InaD-like
NCBI Protein Information
inaD-like protein
UniProt Protein Name
InaD-like protein
Protein Family
UniProt Gene Name
INADL
UniProt Synonym Gene Names
PATJ; Inadl protein; hINADL
UniProt Entry Name
INADL_HUMAN

NCBI Description

This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. [provided by RefSeq, Jul 2008]

Uniprot Description

INADL: Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: tight junction; protein complex; perinuclear region of cytoplasm; apical plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: intercellular junction assembly and maintenance

Research Articles on PATJ

Similar Products

Product Notes

The PATJ inadl (Catalog #AAA3206624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PATJ Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PATJ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PATJ inadl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVMVATLDTQ IADDAELQKY SKLLPIHTLR LGVEVDSFDG HHYISSIVSG. It is sometimes possible for the material contained within the vial of "PATJ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.