Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PARVG rabbit polyclonal antibody. Western Blot analysis of PARVG expression in human spleen.)

Rabbit anti-Human PARVG Polyclonal Antibody | anti-PARVG antibody

PARVG (Gamma-parvin, Parvin, gamma)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PARVG; Polyclonal Antibody; PARVG (Gamma-parvin; Parvin; gamma); Anti -PARVG (Gamma-parvin; anti-PARVG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PARVG.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Applicable Applications for anti-PARVG antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PARVG, aa1-331 (NP_071424.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PARVG rabbit polyclonal antibody. Western Blot analysis of PARVG expression in human spleen.)

Western Blot (WB) (PARVG rabbit polyclonal antibody. Western Blot analysis of PARVG expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of PARVG expression in transfected 293T cell line by PARVG polyclonal antibody. Lane 1: PARVG transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PARVG expression in transfected 293T cell line by PARVG polyclonal antibody. Lane 1: PARVG transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PARVG antibody
Probably plays a role in the regulation of cell adhesion and cytoskeleton organization.
Product Categories/Family for anti-PARVG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37,485 Da
NCBI Official Full Name
PARVG
NCBI Official Synonym Full Names
parvin, gamma
NCBI Official Symbol
PARVG
NCBI Protein Information
gamma-parvin
UniProt Protein Name
Gamma-parvin
Protein Family
UniProt Gene Name
PARVG
UniProt Entry Name
PARVG_HUMAN

NCBI Description

Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004]

Uniprot Description

Function: Probably plays a role in the regulation of cell adhesion and cytoskeleton organization

By similarity.

Subunit structure: Interacts with integrin-linked protein kinase and actin

By similarity.

Subcellular location: Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side

By similarity. Cytoplasm › cytoskeleton

By similarity. Note: Constituent of focal adhesions

By similarity.

Tissue specificity: Expressed predominantly in lymphoid organs, including spleen, thymus, lymph node, bone marrow and peripheral blood leukocytes and moderately in the digestive tract, including stomach, duodenum, jejunum, ileum, ileocecum and appendix, as well as in lung and liver. Also expressed in tumors, but at a lower level than in the corresponding normal tissues. Ref.7

Sequence similarities: Belongs to the parvin family.Contains 2 CH (calponin-homology) domains.

Research Articles on PARVG

Similar Products

Product Notes

The PARVG parvg (Catalog #AAA649005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARVG (Gamma-parvin, Parvin, gamma) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARVG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PARVG parvg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEPEFLYDLL QLPKGVEPPA EEELSKGGKK KYLPPTSRKD PKFEELQKVL MEWINATLLP EHIVVRSLEE DMFDGLILHH LFQRLAALKL EAEDIALTAT SQKHKLTVVL EAVNRSLQLE EWQAKWSVES IFNKDLLSTL HLLVALAKRF QPDLSLPTNV QVEVITIEST KSGLKSEKLV EQLTEYSTDK DEPPKDVFDE LFKLAPEKVN AVKEAIVNFV NQKLDRLGLS VQNLDTQFAD GVILLLLIGQ LEGFFLHLKE FYLTPNSPAE MLHNVTLALE LLKDEGLLSC PVSPEDIVNK DAKSTLRVLY GLFCKHTQKA HRDRTPHGAP N. It is sometimes possible for the material contained within the vial of "PARVG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.