Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PARS2 Polyclonal Antibody)

Rabbit anti-Rat PARS2 Polyclonal Antibody | anti-PARS2 antibody

PARS2 Polyclonal Antibody

Gene Names
PARS2; proRS; EIEE75; MT-PRORS
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PARS2; Polyclonal Antibody; PARS2 Polyclonal Antibody; MT-PRORS; proRS; probable proline--tRNA ligase; mitochondrial; anti-PARS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.58 mg/ml (varies by lot)
Sequence Length
475
Applicable Applications for anti-PARS2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human PARS2 (NP_689481.2).
Immunogen Sequence
HHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQ
Positive Samples
Rat Brain
Cellular Location
Mitochondrion Matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PARS2 Polyclonal Antibody)

Western Blot (WB) (Western blot-PARS2 Polyclonal Antibody)
Related Product Information for anti-PARS2 antibody
This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of proline to tRNA molecules. Mutations have been found in this gene in some patients with Alpers syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 53kDa
Observed: 55kDa
NCBI Official Full Name
Prolyl-tRNA synthetase 2, mitochondrial (putative)
NCBI Official Synonym Full Names
prolyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
PARS2
NCBI Official Synonym Symbols
proRS; EIEE75; MT-PRORS
NCBI Protein Information
probable proline--tRNA ligase, mitochondrial
UniProt Protein Name
Probable proline--tRNA ligase, mitochondrial
UniProt Gene Name
PARS2
UniProt Synonym Gene Names
ProRS
UniProt Entry Name
SYPM_HUMAN

NCBI Description

This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of proline to tRNA molecules. Mutations have been found in this gene in some patients with Alpers syndrome. [provided by RefSeq, Mar 2015]

Research Articles on PARS2

Similar Products

Product Notes

The PARS2 pars2 (Catalog #AAA9140892) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARS2 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PARS2 pars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.