<
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Rabbit PARP6 Polyclonal Antibody | anti-PARP6 antibody
PARP6 antibody - N-terminal region
Gene Names
PARP6; ARTD17; pART17; PARP-6-C; PARP-6-B1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PARP6; Polyclonal Antibody; PARP6 antibody - N-terminal region; anti-PARP6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI
Sequence Length
630
Applicable Applications for anti-PARP6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PARP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlPARP6 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(Host: RabbitTarget Name: PARP6Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlPARP6 is supported by BioGPS gene expression data to be expressed in MCF7)
Western Blot (WB)
(WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysate)
Related Product Information for anti-PARP6 antibody
This is a rabbit polyclonal antibody against PARP6. It was validated on Western Blot
Target Description: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Target Description: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Product Categories/Family for anti-PARP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
protein mono-ADP-ribosyltransferase PARP6 isoform 1
NCBI Official Synonym Full Names
poly(ADP-ribose) polymerase family member 6
NCBI Official Symbol
PARP6
NCBI Official Synonym Symbols
ARTD17; pART17; PARP-6-C; PARP-6-B1
NCBI Protein Information
protein mono-ADP-ribosyltransferase PARP6; poly [ADP-ribose] polymerase 6
UniProt Protein Name
Poly [ADP-ribose] polymerase 6
Protein Family
UniProt Gene Name
PARP6
UniProt Synonym Gene Names
PARP-6; ARTD17
UniProt Entry Name
PARP6_HUMAN
Research Articles on PARP6
Similar Products
Product Notes
The PARP6 parp6 (Catalog #AAA3201718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARP6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PARP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PARP6 parp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDIKGQFWND DDSEGDNESE EFLYGVQGSC AADLYRHPQL DADIEAVKEI. It is sometimes possible for the material contained within the vial of "PARP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
