Rabbit PARP12 Polyclonal Antibody | anti-PARP12 antibody

PARP12 Polyclonal Antibody

Cat. Num. AAA9134322

• Gene Names: PARP12; ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: PARP12; Polyclonal Antibody; PARP12 Polyclonal Antibody; ARTD12; MST109; MSTP109; ZC3H1; ZC3HDC1; anti-PARP12 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: YVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ
• Sequence Length: 701

• Applicable Applications for anti-PARP12 antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human PARP12
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Nucleus
• Positive Samples: HT-29, HeLa, Mouse brain, Mouse liver, Mouse pancreas, Rat brain
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PARP12 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Product Categories/Family for anti-PARP12 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 12232413
• NCBI GeneID: 64761
• NCBI Accession #: NP_073587.1
• NCBI GenBank Nucleotide #: NM_022750.3
• UniProt Accession #: Q9H0J9; Q9H610; Q9NP36; Q9NTI3
• Molecular Weight: Calculated: 79kDa; Observed: 79kDa
• NCBI Official Full Name: poly
• NCBI Official Synonym Full Names: poly(ADP-ribose) polymerase family member 12
• NCBI Official Symbol: PARP12
• NCBI Official Synonym Symbols: ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1
• NCBI Protein Information: poly [ADP-ribose] polymerase 12
• UniProt Protein Name: Poly [ADP-ribose] polymerase 12
• Protein Family: Poly [ADP-ribose] polymerase
• UniProt Gene Name: PARP12
• UniProt Synonym Gene Names: ZC3HDC1; PARP-12; ARTD12