Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit PARP12 Polyclonal Antibody | anti-PARP12 antibody

PARP12 Polyclonal Antibody

Gene Names
PARP12; ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PARP12; Polyclonal Antibody; PARP12 Polyclonal Antibody; ARTD12; MST109; MSTP109; ZC3H1; ZC3HDC1; anti-PARP12 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ
Sequence Length
701
Applicable Applications for anti-PARP12 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human PARP12
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
HT-29, HeLa, Mouse brain, Mouse liver, Mouse pancreas, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PARP12 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Product Categories/Family for anti-PARP12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 79kDa
Observed: 79kDa
NCBI Official Full Name
poly
NCBI Official Synonym Full Names
poly(ADP-ribose) polymerase family member 12
NCBI Official Symbol
PARP12
NCBI Official Synonym Symbols
ZC3H1; ARTD12; MST109; MSTP109; ZC3HDC1
NCBI Protein Information
poly [ADP-ribose] polymerase 12
UniProt Protein Name
Poly [ADP-ribose] polymerase 12
UniProt Gene Name
PARP12
UniProt Synonym Gene Names
ZC3HDC1; PARP-12; ARTD12

Research Articles on PARP12

Similar Products

Product Notes

The PARP12 parp12 (Catalog #AAA9134322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARP12 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PARP12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the PARP12 parp12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YVSPQDVTTM QTCNTKFPGP KSIPDYWDSS ALPDPGFQKI TLSSSSEEYQ KVWNLFNRTL PFYFVQKIER VQNLALWEVY QWQKGQMQKQ NGGKAVDERQ LFHGTSAIFV DAICQQNFDW RVCGVHGTSY GKGSYFARDA AYSHHYSKSD TQTHTMFLAR VLVGEFVRGN ASFVRPPAKE GWSNAFYDSC VNSVSDPSIF VIFEKHQVYP EYVIQYTTSS KPSVTPSILL ALGSLFSSRQ. It is sometimes possible for the material contained within the vial of "PARP12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual