Western Blot (WB)
(Host: RabbitTarget Name: PAN3Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PAN3 Polyclonal Antibody | anti-PAN3 antibody
PAN3 Antibody - middle region
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PAN3; Polyclonal Antibody; PAN3 Antibody - middle region; anti-PAN3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHSPKITPHTSPAPRRRSHTPNPASYMVPSSASTSVNNPVSQTPSSGQVI
Sequence Length
575
Applicable Applications for anti-PAN3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PAN3Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PAN3Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-PAN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
PAN2-PAN3 deadenylation complex subunit PAN3
NCBI Official Synonym Full Names
poly(A) specific ribonuclease subunit PAN3
NCBI Official Symbol
PAN3
NCBI Protein Information
PAN2-PAN3 deadenylation complex subunit PAN3
UniProt Protein Name
PAB-dependent poly(A)-specific ribonuclease subunit PAN3
UniProt Gene Name
PAN3
UniProt Entry Name
PAN3_HUMAN
Uniprot Description
PAN3: Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, recruits polyadenylate-binding protein which in turn stimulates PAN2 nuclease activity. Belongs to the protein kinase superfamily. 4 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 13q12.2
Cellular Component: cytosol
Molecular Function: protein binding; poly(A)-specific ribonuclease activity; metal ion binding; transferase activity, transferring phosphorus-containing groups; ATP binding
Biological Process: deadenylation-dependent decapping; poly(A) tail shortening; gene expression; protein targeting; mRNA catabolic process, deadenylation-dependent decay
Research Articles on PAN3
Similar Products
Product Notes
The PAN3 pan3 (Catalog #AAA3221146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAN3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAN3 pan3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHSPKITPHT SPAPRRRSHT PNPASYMVPS SASTSVNNPV SQTPSSGQVI. It is sometimes possible for the material contained within the vial of "PAN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
