Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PAG1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit PAG1 Polyclonal Antibody | anti-PAG1 antibody

PAG1 antibody - C-terminal region

Gene Names
PAG1; CBP; PAG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PAG1; Polyclonal Antibody; PAG1 antibody - C-terminal region; anti-PAG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYE
Sequence Length
432
Applicable Applications for anti-PAG1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PAG1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-PAG1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-PAG1 antibody
This is a rabbit polyclonal antibody against PAG1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.
Product Categories/Family for anti-PAG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
phosphoprotein associated with glycosphingolipid-enriched microdomains 1
NCBI Official Synonym Full Names
phosphoprotein membrane anchor with glycosphingolipid microdomains 1
NCBI Official Symbol
PAG1
NCBI Official Synonym Symbols
CBP; PAG
NCBI Protein Information
phosphoprotein associated with glycosphingolipid-enriched microdomains 1
UniProt Protein Name
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
Protein Family
UniProt Gene Name
PAG1
UniProt Synonym Gene Names
CBP; PAG
UniProt Entry Name
PHAG1_HUMAN

NCBI Description

The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation. [provided by RefSeq, Jul 2008]

Uniprot Description

PAG: an ubiquitous type III transmembrane adaptor protein that binds to the tyrosine kinase CSK protein. It is thought to be involved in the regulation of T cell activation.

Protein type: Membrane protein, integral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: plasma membrane; integral to membrane; lipid raft

Molecular Function: protein binding; SH3/SH2 adaptor activity; SH2 domain binding

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of signal transduction; signal transduction; negative regulation of T cell activation; T cell receptor signaling pathway; regulation of T cell activation

Research Articles on PAG1

Similar Products

Product Notes

The PAG1 pag1 (Catalog #AAA3216174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAG1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAG1 pag1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNSTLPPAGR PSEEPEPDYE AIQTLNREEE KATLGTNGHH GLVPKENDYE. It is sometimes possible for the material contained within the vial of "PAG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.