Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-P2RY13 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit P2RY13 Polyclonal Antibody | anti-P2RY13 antibody

P2RY13 antibody - C-terminal region

Gene Names
P2RY13; GPCR1; GPR86; GPR94; P2Y13; SP174; FKSG77
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RY13; Polyclonal Antibody; P2RY13 antibody - C-terminal region; anti-P2RY13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPY
Sequence Length
354
Applicable Applications for anti-P2RY13 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 77%; Horse: 79%; Human: 100%; Pig: 86%; Rabbit: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RY13 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-P2RY13 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-P2RY13 antibody
This is a rabbit polyclonal antibody against P2RY13. It was validated on Western Blot

Target Description: The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP.
Product Categories/Family for anti-P2RY13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
P2Y purinoceptor 13
NCBI Official Synonym Full Names
purinergic receptor P2Y13
NCBI Official Symbol
P2RY13
NCBI Official Synonym Symbols
GPCR1; GPR86; GPR94; P2Y13; SP174; FKSG77
NCBI Protein Information
P2Y purinoceptor 13
UniProt Protein Name
P2Y purinoceptor 13
Protein Family
UniProt Gene Name
P2RY13
UniProt Synonym Gene Names
GPR86; GPR94; P2Y13
UniProt Entry Name
P2Y13_HUMAN

NCBI Description

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP. [provided by RefSeq, Sep 2008]

Uniprot Description

P2RY13: Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: integral to plasma membrane; endoplasmic reticulum; plasma membrane

Molecular Function: purinergic nucleotide receptor activity, G-protein coupled

Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of adenylate cyclase activity

Research Articles on P2RY13

Similar Products

Product Notes

The P2RY13 p2ry13 (Catalog #AAA3216596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RY13 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's P2RY13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RY13 p2ry13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVIAKKVYDS YRKSKSKDRK NNKKLEGKVF VVVAVFFVCF APFHFARVPY. It is sometimes possible for the material contained within the vial of "P2RY13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.