Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TNFRSF11B expression in transfected 293T cell line by TNFRSF11B polyclonal antibody. Lane 1: TNFRSF11B transfected lysate (46kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Osteoprotegerin Polyclonal Antibody | anti-OPG antibody

Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (HRP)

Gene Names
TNFRSF11B; OPG; TR1; OCIF; PDB5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Osteoprotegerin; Polyclonal Antibody; Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; TNFRSF11B; OCIF; OPG) (HRP); anti-OPG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TNFRSF11B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-OPG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TNFRSF11B, aa1-401 (AAH30155.1).
Immunogen Sequence
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TNFRSF11B expression in transfected 293T cell line by TNFRSF11B polyclonal antibody. Lane 1: TNFRSF11B transfected lysate (46kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TNFRSF11B expression in transfected 293T cell line by TNFRSF11B polyclonal antibody. Lane 1: TNFRSF11B transfected lysate (46kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-OPG antibody
Human OPG (Osteoprotegerin), also known as OCIF (Osteoclastogenesis inhibitory factor), is a member of the TNF receptor superfamily. It specifically acts on bone tissues and increases bone mineral density and bone volume associated with a decrease of active osteoclast number. Human OPG is a 20kD protein, comprising of 174aa residues.
Product Categories/Family for anti-OPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,026 Da
NCBI Official Full Name
Homo sapiens tumor necrosis factor receptor superfamily, member 11b, mRNA
NCBI Official Synonym Full Names
TNF receptor superfamily member 11b
NCBI Official Symbol
TNFRSF11B
NCBI Official Synonym Symbols
OPG; TR1; OCIF; PDB5
NCBI Protein Information
tumor necrosis factor receptor superfamily member 11B
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 11B
UniProt Gene Name
TNFRSF11B
UniProt Synonym Gene Names
OCIF; OPG
UniProt Entry Name
TR11B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF11B: Acts as decoy receptor for RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local RANKL/OPG ratio. May also play a role in preventing arterial calcification. May act as decoy receptor for TRAIL and protect against apoptosis. TRAIL binding blocks the inhibition of osteoclastogenesis. Defects in TNFRSF11B are the cause of juvenile Paget disease (JPD); also known as hyperostosis corticalis deformans juvenilis or hereditary hyperphosphatasia or chronic congenital idiopathic hyperphosphatasia. JPD is a rare autosomal recessive osteopathy that presents in infancy or early childhood. The disorder is characterized by rapidly remodeling woven bone, osteopenia, debilitating fractures, and deformities due to a markedly accelerated rate of bone remodeling throughout the skeleton. Approximately 40 cases of JPD have been reported worldwide. Unless it is treated with drugs that block osteoclast- mediated skeletal resorption, the disease can be fatal.

Protein type: Secreted; Inhibitor; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region

Molecular Function: cytokine activity; receptor activity

Biological Process: response to drug; response to magnesium ion; extracellular matrix organization and biogenesis; negative regulation of odontogenesis of dentine-containing teeth; response to estrogen stimulus; apoptosis; response to arsenic; signal transduction; negative regulation of bone resorption; skeletal development; response to nutrient

Disease: Paget Disease, Juvenile

Research Articles on OPG

Similar Products

Product Notes

The OPG tnfrsf11b (Catalog #AAA6388133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Osteoprotegerin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OPG tnfrsf11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Osteoprotegerin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.