Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Osteopontin antibody, Western blottingAll lanes: Anti Osteopontin at 0.5ug/ml)

Osteopontin Polyclonal Antibody | anti-SPP1 antibody

Anti-Osteopontin Antibody

Gene Names
SPP1; OPN; BNSP; BSPI; ETA-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
Osteopontin; Polyclonal Antibody; Anti-Osteopontin Antibody; BNSP; Bone sialoprotein 1; BSP I; BSPI; Early T lymphocyte activation 1; ETA 1; ETA1; MGC110940; Nephropontin; OPN; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; OSTP_HUMAN; PSEC0156; secreted phosphoprotein 1 (osteopontin; bone sialoprotein I; early T-lymphocyte activation 1); Secreted phosphoprotein 1; SPP 1; SPP-1; SPP1; SPP1/CALPHA1 fusion; Urinary stone protein; Uropontin; secreted phosphoprotein 1; anti-SPP1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
300
Applicable Applications for anti-SPP1 antibody
Western Blot (WB), ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Osteopontin antibody, Western blottingAll lanes: Anti Osteopontin at 0.5ug/ml)

Western Blot (WB) (Anti- Osteopontin antibody, Western blottingAll lanes: Anti Osteopontin at 0.5ug/ml)
Related Product Information for anti-SPP1 antibody
Description: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human;Mouse;Rat.

Background: Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: SPP1 secreted phosphoprotein 1". 2. Reinholt FP, Hultenby K, Oldberg A, Heinegård D (June 1990). "Osteopontin--a possible anchor of osteoclasts to bone". Proc. Natl. Acad. Sci. U.S.A. 87 (12): 4473-5. 3. Wang KX, Denhardt DT (2008). "Osteopontin: role in immune regulation and stress responses". Cytokine Growth Factor Rev. 19 (5-6): 333-45.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,843 Da
NCBI Official Full Name
osteopontin isoform OPN-b
NCBI Official Synonym Full Names
secreted phosphoprotein 1
NCBI Official Symbol
SPP1
NCBI Official Synonym Symbols
OPN; BNSP; BSPI; ETA-1
NCBI Protein Information
osteopontin
UniProt Protein Name
Osteopontin
Protein Family
UniProt Gene Name
SPP1
UniProt Synonym Gene Names
BNSP; OPN; SPP-1
UniProt Entry Name
OSTP_HUMAN

NCBI Description

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

osteopontin: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Belongs to the osteopontin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: cell projection; extracellular region; extracellular space; perinuclear region of cytoplasm

Molecular Function: cytokine activity; extracellular matrix binding; protein binding

Biological Process: biomineral formation; cell adhesion; decidualization; embryo implantation; extracellular matrix disassembly; extracellular matrix organization and biogenesis; inflammatory response; negative regulation of collateral sprouting of intact axon in response to injury; osteoblast differentiation; positive regulation of bone resorption; response to steroid hormone stimulus; response to vitamin D

Research Articles on SPP1

Similar Products

Product Notes

The SPP1 spp1 (Catalog #AAA178082) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Osteopontin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Osteopontin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SPP1 spp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Osteopontin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.