Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OSMRSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit OSMR Polyclonal Antibody | anti-OSMR antibody

OSMR antibody - N-terminal region

Gene Names
OSMR; OSMRB; PLCA1; IL-31RB; IL-31R-beta
Reactivity
Cow, Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OSMR; Polyclonal Antibody; OSMR antibody - N-terminal region; anti-OSMR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
Sequence Length
979
Applicable Applications for anti-OSMR antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OSMR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OSMRSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OSMRSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysateOSMR is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-OSMR Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysateOSMR is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-OSMR antibody
This is a rabbit polyclonal antibody against OSMR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF.Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-OSMR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110kDa
NCBI Official Full Name
oncostatin-M-specific receptor subunit beta isoform 1
NCBI Official Synonym Full Names
oncostatin M receptor
NCBI Official Symbol
OSMR
NCBI Official Synonym Symbols
OSMRB; PLCA1; IL-31RB; IL-31R-beta
NCBI Protein Information
oncostatin-M-specific receptor subunit beta
UniProt Protein Name
Oncostatin-M-specific receptor subunit beta
UniProt Gene Name
OSMR
UniProt Synonym Gene Names
OSMRB; IL-31 receptor subunit beta; IL-31R subunit beta; IL-31R-beta; IL-31RB

NCBI Description

This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.

Research Articles on OSMR

Similar Products

Product Notes

The OSMR osmr (Catalog #AAA3208190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSMR antibody - N-terminal region reacts with Cow, Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSMR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSMR osmr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQSEVLAERL PLTPVSLKVS TNSTRQSLHL QWTVHNLPYH QELKMVFQIQ. It is sometimes possible for the material contained within the vial of "OSMR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.