Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OSCAR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit anti-Human OSCAR Polyclonal Antibody | anti-OSCAR antibody

OSCAR antibody - C-terminal region

Gene Names
OSCAR; PIGR3; PIgR-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OSCAR; Polyclonal Antibody; OSCAR antibody - C-terminal region; anti-OSCAR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQN
Sequence Length
252
Applicable Applications for anti-OSCAR antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OSCAR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-OSCAR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-OSCAR antibody
This is a rabbit polyclonal antibody against OSCAR. It was validated on Western Blot

Target Description: Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-OSCAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
osteoclast-associated immunoglobulin-like receptor isoform 5
NCBI Official Synonym Full Names
osteoclast associated Ig-like receptor
NCBI Official Symbol
OSCAR
NCBI Official Synonym Symbols
PIGR3; PIgR-3
NCBI Protein Information
osteoclast-associated immunoglobulin-like receptor
UniProt Protein Name
Osteoclast-associated immunoglobulin-like receptor
UniProt Gene Name
OSCAR
UniProt Synonym Gene Names
Osteoclast-associated receptor; hOSCAR; PIgR-3; PIgR3
UniProt Entry Name
OSCAR_HUMAN

NCBI Description

Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

OSCAR: Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation. Belongs to the leukocyte receptor complex/polymeric immunogobulin receptor (PIR/LRC) family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: plasma membrane; integral to membrane

Research Articles on OSCAR

Similar Products

Product Notes

The OSCAR oscar (Catalog #AAA3215871) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSCAR antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSCAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSCAR oscar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSQRSEVLVI SWEDSGSSDY TRGNLVRLGL AGLVLISLGA LVTFDWRSQN. It is sometimes possible for the material contained within the vial of "OSCAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.