Western Blot (WB)
(Host: RabbitTarget Name: OSBPL2Sample Tissue: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human OSBPL2 Polyclonal Antibody | anti-OSBPL2 antibody
OSBPL2 Antibody - N-terminal region
Gene Names
OSBPL2; ORP2; ORP-2; DFNA67; DNFA67
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
OSBPL2; Polyclonal Antibody; OSBPL2 Antibody - N-terminal region; anti-OSBPL2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSL
Sequence Length
480
Applicable Applications for anti-OSBPL2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: OSBPL2Sample Tissue: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: OSBPL2Sample Tissue: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OSBPL2 antibody
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-OSBPL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
oxysterol-binding protein-related protein 2 isoform 1
NCBI Official Synonym Full Names
oxysterol binding protein like 2
NCBI Official Symbol
OSBPL2
NCBI Official Synonym Symbols
ORP2; ORP-2; DFNA67; DNFA67
NCBI Protein Information
oxysterol-binding protein-related protein 2
UniProt Protein Name
Oxysterol-binding protein-related protein 2
Protein Family
UniProt Gene Name
OSBPL2
UniProt Synonym Gene Names
KIAA0772; ORP2; ORP-2; OSBP-related protein 2
UniProt Entry Name
OSBL2_HUMAN
NCBI Description
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2014]
Research Articles on OSBPL2
Similar Products
Product Notes
The OSBPL2 osbpl2 (Catalog #AAA3220934) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSBPL2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSBPL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OSBPL2 osbpl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSDNSSGEFS EANQKVTGMI DLDTSKNNRI GKTGERPSQE NGIQKHRTSL. It is sometimes possible for the material contained within the vial of "OSBPL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
