Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- NUR77 Picoband antibody, MBS177954, Western blottingAll lanes: Anti NUR77 (MBS177954) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD )

NUR77 Polyclonal Antibody | anti-NUR77 antibody

Anti-NUR77 Antibody

Gene Names
NR4A1; HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
NUR77; Polyclonal Antibody; Anti-NUR77 Antibody; Nuclear receptor subfamily 4 group A member 1; Early response protein NAK1; GFRP 1; GFRP; GFRP1; Growth factor inducible nuclear protein N10; Growth Factor Inducible Nuclear Protein NP10; Growth Factor Response Protein 1; Hbr1; HMR; Hormone Receptor; MGC9485; N10; N10 nuclear protein; NAK 1; NAK1; Nerve growth factor IB nuclear receptor variant 1; NGFIB; NP 10; NP10; NR4A1; NR4A1_HUMAN; Nuclear hormone receptor NUR/77; Nuclear Hormone Receptor TR3; Nuclear Receptor Subfamily 4 Group A Member 1; NUR 77; Orphan nuclear receptor HMR; Orphan nuclear receptor NR4A1; Orphan nuclear receptor TR3; ST 59; ST-59; ST59; Steroid receptor TR3; Testicular receptor 3; TR 3; TR3; TR3 orphan receptor antibody; nuclear receptor subfamily 4; group A; member 1; anti-NUR77 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
611
Applicable Applications for anti-NUR77 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human NUR77 (372-408aa HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- NUR77 Picoband antibody, MBS177954, Western blottingAll lanes: Anti NUR77 (MBS177954) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD )

Western Blot (WB) (Anti- NUR77 Picoband antibody, MBS177954, Western blottingAll lanes: Anti NUR77 (MBS177954) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD )
Related Product Information for anti-NUR77 antibody
Description: Rabbit IgG polyclonal antibody for Nuclear receptor subfamily 4 group A member 1(NR4A1) detection. Tested with WB in Human;Mouse;Rat.

Background: NR4A1 (NUCLEAR RECEPTOR SUBFAMILY 4, GROUP A, MEMBER 1), also called NAK1, GFRP1, TR3, NUR77 or NGFIB, is a protein that in humans is encoded by the NR4A1 gene, which is also a member of the Nur nuclear receptor family of intracellular transcription factors. The NR4A1 gene is mapped on 12q13.13. NR4A1 is involved in cell cycle mediation, inflammation and apoptosis. It plays a key role in mediating inflammatory responses in macrophages. In addition, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells. Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells. Nr4a1 is also induced by lithium, a Wnt1 mimic, and the Nr4a1 promoter is activated by lithium and beta-catenin, a Wnt1 downstream effector. In contrast, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells. Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, stimulates glucose production both in vitro and in vivo, and raises blood glucose levels.
References
1. Chang, C., Kokontis, J., Liao, S. S., Chang, Y. Isolation and characterization of human TR3 receptor: a member of steroid receptor superfamily. J. Steroid Biochem. 34: 391-395, 1989. 2. Dequiedt, F., Kasler, H., Fischle, W., Kiermer, V., Weinstein, M., Herndier, B. G., Verdin, E. HDAC7, a thymus-specific class II histone deacetylase, regulates Nur77 transcription and TCR-mediated apoptosis. Immunity 18: 687-698, 2003. 3. Forman, B. M., Umesono, K., Chen, J., Evans, R. M. Unique response pathways are established by allosteric interactions among nuclear hormone receptors. Cell 81: 541-550, 1995.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,754 Da
NCBI Official Full Name
nuclear receptor subfamily 4 group A member 1 isoform 2
NCBI Official Synonym Full Names
nuclear receptor subfamily 4 group A member 1
NCBI Official Symbol
NR4A1
NCBI Official Synonym Symbols
HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
NCBI Protein Information
nuclear receptor subfamily 4 group A member 1
UniProt Protein Name
Nuclear receptor subfamily 4 group A member 1
UniProt Gene Name
NR4A1
UniProt Synonym Gene Names
GFRP1; HMR; NAK1; Nur77
UniProt Entry Name
NR4A1_HUMAN

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

Nur77: an orphan nuclear receptor and immediate-early gene that regulates cellular proliferation, apoptosis, inflammation, and glucose metabolism. Induced by exercise in muscle and is a functional regulator of glucose metabolism in skeletal muscle. Its level decreases in the muscle of obese insulin-resistant men. Acts concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. A mediator of TCR-directed thymocyte apoptosis. TCR-signaling induces a FAIM/Akt/Nur77 signaling pathway that is critical for modulating apoptosis in developing thymocytes. A physiological substrate of the MEK-ERK-RSK cascade that modulates nuclear export and intracellular translocation during T cell death. Binds DNA as a monomer. Interacts with GADD45GIP1. Overexpression of Nur77 induces the expression of both p300 and HDAC1. Acetylation by p300 and HDAC1 may regulate the rapid turnover of Nur77 protein.

Protein type: Apoptosis; DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cytoplasm; nuclear membrane; nucleoplasm; nucleus

Molecular Function: DNA binding; ligand-dependent nuclear receptor activity; protein binding; protein heterodimerization activity; sequence-specific DNA binding; steroid hormone receptor activity; zinc ion binding

Biological Process: cell migration during sprouting angiogenesis; fat cell differentiation; intracellular receptor-mediated signaling pathway; negative regulation of cell cycle; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; signal transduction; steroid hormone mediated signaling; transcription initiation from RNA polymerase II promoter

Research Articles on NUR77

Similar Products

Product Notes

The NUR77 nr4a1 (Catalog #AAA177954) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-NUR77 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUR77 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the NUR77 nr4a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUR77, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.