Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

Rabbit NUP155 Polyclonal Antibody | anti-NUP155 antibody

NUP155 antibody - N-terminal region

Gene Names
NUP155; N155; ATFB15
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUP155; Polyclonal Antibody; NUP155 antibody - N-terminal region; anti-NUP155 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISR
Sequence Length
1332
Applicable Applications for anti-NUP155 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NUP155
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Related Product Information for anti-NUP155 antibody
This is a rabbit polyclonal antibody against NUP155. It was validated on Western Blot

Target Description: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.
Product Categories/Family for anti-NUP155 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
147kDa
NCBI Official Full Name
nuclear pore complex protein Nup155 isoform 2
NCBI Official Synonym Full Names
nucleoporin 155
NCBI Official Symbol
NUP155
NCBI Official Synonym Symbols
N155; ATFB15
NCBI Protein Information
nuclear pore complex protein Nup155
UniProt Protein Name
Nuclear pore complex protein Nup155
UniProt Gene Name
NUP155
UniProt Synonym Gene Names
KIAA0791
UniProt Entry Name
NU155_HUMAN

NCBI Description

Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6. [provided by RefSeq, May 2013]

Uniprot Description

NUP155: Essential component of nuclear pore complex. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport. Belongs to the non-repetitive/WGA-negative nucleoporin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleoporin

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: nuclear membrane; membrane; nuclear pore; nuclear envelope

Molecular Function: structural constituent of nuclear pore; transporter activity

Biological Process: viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; nuclear membrane organization and biogenesis; mRNA export from nucleus; protein import into nucleus; hexose transport; carbohydrate metabolic process; viral transcription; gene expression; mitotic cell cycle; transmembrane transport

Disease: Atrial Fibrillation, Familial, 15

Research Articles on NUP155

Similar Products

Product Notes

The NUP155 nup155 (Catalog #AAA3211408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUP155 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NUP155 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUP155 nup155 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPLQGPGLLS VPNLPEISSI RRVPLPPELV EQFGHMQCNC MMGVFPPISR. It is sometimes possible for the material contained within the vial of "NUP155, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.