Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NUDT14Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NUDT14 Polyclonal Antibody | anti-NUDT14 antibody

NUDT14 Antibody - middle region

Gene Names
NUDT14; UGPP; UGPPase
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT14; Polyclonal Antibody; NUDT14 Antibody - middle region; anti-NUDT14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK
Sequence Length
222
Applicable Applications for anti-NUDT14 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NUDT14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NUDT14Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NUDT14Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NUDT14 antibody
This is a rabbit polyclonal antibody against NUDT14. It was validated on Western Blot

Target Description: UDP-glucose (UDPG) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. NUDT14 is a UDPG pyrophosphatase that hydrolyzes UDPG to produce glucose 1-phosphate and UMP.
Product Categories/Family for anti-NUDT14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
uridine diphosphate glucose pyrophosphatase isoform 1
NCBI Official Synonym Full Names
nudix hydrolase 14
NCBI Official Symbol
NUDT14
NCBI Official Synonym Symbols
UGPP; UGPPase
NCBI Protein Information
uridine diphosphate glucose pyrophosphatase
UniProt Protein Name
Uridine diphosphate glucose pyrophosphatase
Protein Family
UniProt Gene Name
NUDT14
UniProt Synonym Gene Names
UGPP; UDPG pyrophosphatase; UGPPase; Nudix motif 14
UniProt Entry Name
NUD14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This enzyme contains a Nudix hydrolase domain and is a UDPG pyrophosphatase that hydrolyzes UDPG to produce glucose 1-phosphate and UMP. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

NUDT14: Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP- mannose. Belongs to the Nudix hydrolase family.

Protein type: EC 3.6.1.45; Hydrolase

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: cytoplasm

Molecular Function: protein binding; ADP-ribose diphosphatase activity; metal ion binding; UDP-sugar diphosphatase activity

Biological Process: metabolic process

Research Articles on NUDT14

Similar Products

Product Notes

The NUDT14 nudt14 (Catalog #AAA3217588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT14 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT14 nudt14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRQTMFYTEV TDAQRSGPGG GLVEEGELIE VVHLPLEGAQ AFADDPDIPK. It is sometimes possible for the material contained within the vial of "NUDT14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.