Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NUDC expression in transfected 293T cell line by NUDC polyclonal antibody. Lane 1: NUDC transfected lysate (38.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NUDC Polyclonal Antibody | anti-NUDC antibody

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (Biotin)

Gene Names
NUDC; HNUDC; MNUDC; NPD011
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUDC; Polyclonal Antibody; NUDC (Nuclear Migration Protein nudC; Nuclear Distribution Protein C Homolog) (Biotin); anti-NUDC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NUDC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NUDC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NUDC, aa1-331 (NP_006591.1).
Immunogen Sequence
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NUDC expression in transfected 293T cell line by NUDC polyclonal antibody. Lane 1: NUDC transfected lysate (38.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NUDC expression in transfected 293T cell line by NUDC polyclonal antibody. Lane 1: NUDC transfected lysate (38.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NUDC antibody
NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).
Product Categories/Family for anti-NUDC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,243 Da
NCBI Official Full Name
nuclear migration protein nudC
NCBI Official Synonym Full Names
nuclear distribution C homolog (A. nidulans)
NCBI Official Symbol
NUDC
NCBI Official Synonym Symbols
HNUDC; MNUDC; NPD011
NCBI Protein Information
nuclear migration protein nudC; nuclear distribution gene C homolog; nuclear distribution protein C homolog
UniProt Protein Name
Nuclear migration protein nudC
Protein Family
UniProt Gene Name
NUDC
UniProt Entry Name
NUDC_HUMAN

NCBI Description

This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2. [provided by RefSeq, Feb 2012]

Uniprot Description

NUDC: a cytoskeletal protein that is a component of the dynactin complex. The cytoplasmic dynein/dynactin complex, a minus-end-directed motor, powers various) aspects of mitosis, including establishment of bipolarity, organization of spindle poles, alignment and segregation of chromosomes, as well as regulation of microtubule dynamics. Phosphorylation by PLK1 may play a critical role in cytokinesis.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: nucleoplasm; microtubule; cytoplasm; cytosol

Molecular Function: protein binding

Biological Process: cell proliferation; mitosis; cell division; multicellular organismal development; mitotic cell cycle

Research Articles on NUDC

Similar Products

Product Notes

The NUDC nudc (Catalog #AAA6387735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUDC nudc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.