Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit NTNG2 Polyclonal Antibody | anti-NTNG2 antibody

NTNG2 Polyclonal Antibody

Gene Names
NTNG2; Lmnt2; NTNG1; LHLL9381; bA479K20.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NTNG2; Polyclonal Antibody; NTNG2 Polyclonal Antibody; bA479K20.1; LHLL9381; Lmnt2; NTNG1; anti-NTNG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLY
Sequence Length
530
Applicable Applications for anti-NTNG2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human NTNG2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-NTNG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa/59kDa
NCBI Official Full Name
netrin-G2
NCBI Official Synonym Full Names
netrin G2
NCBI Official Symbol
NTNG2
NCBI Official Synonym Symbols
Lmnt2; NTNG1; LHLL9381; bA479K20.1
NCBI Protein Information
netrin-G2
UniProt Protein Name
Netrin-G2
Protein Family
UniProt Gene Name
NTNG2
UniProt Synonym Gene Names
KIAA1857; LMNT2

Uniprot Description

Involved in controlling patterning and neuronal circuit formation at the laminar, cellular, subcellular and synaptic levels. Promotes neurite outgrowth of both axons and dendrites.

Research Articles on NTNG2

Similar Products

Product Notes

The NTNG2 ntng2 (Catalog #AAA9134936) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NTNG2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NTNG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the NTNG2 ntng2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DYDICKSWVT TDEGPTWEFY ACQPKVMRLK DYVKVKVEPS GITCGDPPER FCSHENPYLC SNECDASNPD LAHPPRLMFD KEEEGLATYW QSITWSRYPS PLEANITLSW NKTVELTDDV VMTFEYGRPT VMVLEKSLDN GRTWQPYQFY AEDCMEAFGM SARRARDMSS SSAHRVLCTE EYSRWAGSKK EKHVRFEVRD RFAIFAGPDL RNMDNLYTRL ESAKGLKEFF TLTDLRMRLL RPALGGTYVQ RENLY. It is sometimes possible for the material contained within the vial of "NTNG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.