Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NTM1ASample Tissue: Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NTMT1 Polyclonal Antibody | anti-NTMT1 antibody

NTMT1 Antibody - N-terminal region

Gene Names
NTMT1; NRMT; NRMT1; NTM1A; AD-003; HOMT1A; C9orf32; METTL11A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NTMT1; Polyclonal Antibody; NTMT1 Antibody - N-terminal region; anti-NTMT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: KQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
Sequence Length
223
Applicable Applications for anti-NTMT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human NTM1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NTM1ASample Tissue: Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NTM1ASample Tissue: Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NTMT1 antibody
N-terminal Xaa-Pro-Lys N-methyltransferase 1

Target Description: The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).[supplied by OMIM, Nov 2010]
Product Categories/Family for anti-NTMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
N-terminal Xaa-Pro-Lys N-methyltransferase 1 isoform a
NCBI Official Synonym Full Names
N-terminal Xaa-Pro-Lys N-methyltransferase 1
NCBI Official Symbol
NTMT1
NCBI Official Synonym Symbols
NRMT; NRMT1; NTM1A; AD-003; HOMT1A; C9orf32; METTL11A
NCBI Protein Information
N-terminal Xaa-Pro-Lys N-methyltransferase 1
UniProt Protein Name
N-terminal Xaa-Pro-Lys N-methyltransferase 1
UniProt Gene Name
NTMT1
UniProt Synonym Gene Names
C9orf32; METTL11A; NRMT; NRMT1; NTM1A
UniProt Entry Name
NTM1A_HUMAN

NCBI Description

The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).[supplied by OMIM, Nov 2010]

Uniprot Description

METTL11A: Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]- Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di- methylation of Pro in the Pro-Pro-Lys motif. Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1. Belongs to the methyltransferase superfamily. NTM1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.244; Methyltransferase; Methyltransferase, protein N-term

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: histone methyltransferase activity; protein methyltransferase activity

Biological Process: chromosome segregation; histone methylation; N-terminal peptidyl-alanine methylation; N-terminal peptidyl-glycine methylation; N-terminal peptidyl-proline di-methylation; spindle organization and biogenesis

Research Articles on NTMT1

Similar Products

Product Notes

The NTMT1 ntmt1 (Catalog #AAA3209151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NTMT1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NTMT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NTMT1 ntmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQIPPTVDGM LGGYGHISSI DINSSRKFLQ RFLREGPNKT GTSCALDCGA. It is sometimes possible for the material contained within the vial of "NTMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.