Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NT5C3Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NT5C3A Polyclonal Antibody | anti-NT5C3A antibody

NT5C3A Antibody - middle region

Gene Names
NT5C3A; p36; PN-I; POMP; PSN1; UMPH; NT5C3; P5N-1; UMPH1; hUMP1; P5'N-1; cN-III
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NT5C3A; Polyclonal Antibody; NT5C3A Antibody - middle region; anti-NT5C3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNI
Sequence Length
336
Applicable Applications for anti-NT5C3A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NT5C3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NT5C3Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NT5C3Sample Tissue: Human HeLa Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NT5C3A antibody
This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
cytosolic 5'-nucleotidase 3A isoform 2
NCBI Official Synonym Full Names
5'-nucleotidase, cytosolic IIIA
NCBI Official Symbol
NT5C3A
NCBI Official Synonym Symbols
p36; PN-I; POMP; PSN1; UMPH; NT5C3; P5N-1; UMPH1; hUMP1; P5'N-1; cN-III
NCBI Protein Information
cytosolic 5'-nucleotidase 3A
UniProt Protein Name
Cytosolic 5'-nucleotidase 3
Protein Family
UniProt Gene Name
NT5C3
UniProt Synonym Gene Names
P5N1; UMPH1; cN-III; P5'N-1; P5N-1; PN-I
UniProt Entry Name
5NT3_HUMAN

NCBI Description

This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. [provided by RefSeq, Mar 2012]

Uniprot Description

NT5C3A: Can act both as nucleotidase and as phosphotransferase. Defects in NT5C3 are the cause of P5N deficiency (P5ND); also called hemolytic anemia due to P5N deficiency or hemolytic anemia due to UMPH1 deficiency. P5ND is an autosomal recessive condition causing hemolytic anemia characterized by marked basophilic stipplig and the accumulation of high concentrations of pyrimidine nucleotides within the erythrocyte. It is implicated in the anemia of lead poisoning and is possibly associated with learning difficulties. Belongs to the pyrimidine 5'-nucleotidase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - pyrimidine; Endoplasmic reticulum; Nucleotide Metabolism - purine; Phosphatase (non-protein); Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 3.1.3.5; Transferase

Chromosomal Location of Human Ortholog: 7p14.3

Cellular Component: mitochondrion; endoplasmic reticulum; cytoplasm; cytosol

Molecular Function: 5'-nucleotidase activity; 2'-phosphotransferase activity; magnesium ion binding; nucleotide binding

Biological Process: pyrimidine nucleoside catabolic process; pyrimidine base metabolic process; dephosphorylation; nucleobase, nucleoside and nucleotide metabolic process; nucleotide metabolic process; adenosine metabolic process; pyrimidine nucleoside metabolic process

Disease: Uridine 5-prime Monophosphate Hydrolase Deficiency, Hemolytic Anemia Due To

Research Articles on NT5C3A

Similar Products

Product Notes

The NT5C3A nt5c3 (Catalog #AAA3221199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5C3A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NT5C3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NT5C3A nt5c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVKVVSNFMD FDETGVLKGF KGELIHVFNK HDGALRNTEY FNQLKDNSNI. It is sometimes possible for the material contained within the vial of "NT5C3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.