Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NT5C1ASample Tissue: Human Lymph Node Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NT5C1A Polyclonal Antibody | anti-NT5C1A antibody

NT5C1A Antibody - N-terminal region

Gene Names
NT5C1A; CN1; CNI; CN-I; CN1A; CN-IA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NT5C1A; Polyclonal Antibody; NT5C1A Antibody - N-terminal region; anti-NT5C1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRA
Sequence Length
368
Applicable Applications for anti-NT5C1A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NT5C1ASample Tissue: Human Lymph Node Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NT5C1ASample Tissue: Human Lymph Node Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NT5C1A antibody
5'-nucleotidase, cytosolic IA

Target Description: Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphatesCytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates.
Product Categories/Family for anti-NT5C1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
cytosolic 5'-nucleotidase 1A
NCBI Official Synonym Full Names
5'-nucleotidase, cytosolic IA
NCBI Official Symbol
NT5C1A
NCBI Official Synonym Symbols
CN1; CNI; CN-I; CN1A; CN-IA
NCBI Protein Information
cytosolic 5'-nucleotidase 1A
UniProt Protein Name
Cytosolic 5'-nucleotidase 1A
Protein Family
UniProt Gene Name
NT5C1A
UniProt Synonym Gene Names
cN1A; cN-I; cN-IA
UniProt Entry Name
5NT1A_HUMAN

NCBI Description

Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates (Hunsucker et al., 2001 [PubMed 11133996]).[supplied by OMIM, Mar 2008]

Uniprot Description

NT5C1A: Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides and has a broad substrate specificity. Helps to regulate adenosine levels in heart during ischemia and hypoxia. Belongs to the 5'-nucleotidase type 3 family.

Protein type: Nucleotide Metabolism - purine; EC 3.1.3.5; Phosphatase (non-protein); Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 1p34.3-p33

Cellular Component: cytosol

Molecular Function: 5'-nucleotidase activity; magnesium ion binding; nucleotide binding

Biological Process: purine nucleoside monophosphate catabolic process; pyrimidine nucleoside catabolic process; pyrimidine base metabolic process; dephosphorylation; nucleobase, nucleoside and nucleotide metabolic process; nucleoside metabolic process; purine nucleotide catabolic process; adenosine metabolic process; purine base metabolic process

Research Articles on NT5C1A

Similar Products

Product Notes

The NT5C1A nt5c1a (Catalog #AAA3214759) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5C1A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NT5C1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NT5C1A nt5c1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPREPGPGAE TAAAPVWEEA KIFYDNLAPK KKPKSPKPQN AVTIAVSSRA. It is sometimes possible for the material contained within the vial of "NT5C1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.