Western Blot (WB)
(WB Suggested Anti-NSUN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Rabbit NSUN3 Polyclonal Antibody | anti-NSUN3 antibody
NSUN3 antibody - C-terminal region
Gene Names
NSUN3; MST077; MSTP077
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NSUN3; Polyclonal Antibody; NSUN3 antibody - C-terminal region; anti-NSUN3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP
Sequence Length
340
Applicable Applications for anti-NSUN3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NSUN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NSUN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-NSUN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-NSUN3 antibody
This is a rabbit polyclonal antibody against NSUN3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NSUN3 belongs to the methyltransferase superfamily. RsmB/NOP family. It may have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Target Description: NSUN3 belongs to the methyltransferase superfamily. RsmB/NOP family. It may have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Product Categories/Family for anti-NSUN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
NCBI Official Synonym Full Names
NOP2/Sun RNA methyltransferase family member 3
NCBI Official Symbol
NSUN3
NCBI Official Synonym Symbols
MST077; MSTP077
NCBI Protein Information
tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
UniProt Protein Name
tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
Protein Family
UniProt Gene Name
NSUN3
Uniprot Description
NSUN3: May have S-adenosyl-L-methionine-dependent methyl- transferase activity. Belongs to the methyltransferase superfamily. RsmB/NOP family.
Protein type: EC 2.1.1.-; Methyltransferase
Chromosomal Location of Human Ortholog: 3q11.2
Cellular Component: mitochondrial large ribosomal subunit; mitochondrial matrix; mitochondrion
Molecular Function: tRNA (cytosine-5-)-methyltransferase activity; tRNA binding
Biological Process: rRNA methylation
Research Articles on NSUN3
Similar Products
Product Notes
The NSUN3 nsun3 (Catalog #AAA3209219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSUN3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NSUN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSUN3 nsun3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPLLQIELLR SAIKALRPGG ILVYSTCTLS KAENQDVISE ILNSHGNIMP. It is sometimes possible for the material contained within the vial of "NSUN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
