Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NSMFSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NSMF Polyclonal Antibody | anti-NSMF antibody

NSMF Antibody - N-terminal region

Gene Names
NSMF; HH9; NELF
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NSMF; Polyclonal Antibody; NSMF Antibody - N-terminal region; anti-NSMF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGCYEGSL
Sequence Length
530
Applicable Applications for anti-NSMF antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSMF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NSMFSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NSMFSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NSMF antibody
This is a rabbit polyclonal antibody against NSMF. It was validated on Western Blot

Target Description: The protein encoded by this gene is involved in guidance of olfactory axon projections and migration of luteinizing hormone-releasing hormone neurons. Defects in this gene are a cause of idiopathic hypogonadotropic hypogonadism (IHH). Several transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
NMDA receptor synaptonuclear signaling and neuronal migration factor
NCBI Official Synonym Full Names
NMDA receptor synaptonuclear signaling and neuronal migration factor
NCBI Official Symbol
NSMF
NCBI Official Synonym Symbols
HH9; NELF
NCBI Protein Information
NMDA receptor synaptonuclear signaling and neuronal migration factor
UniProt Protein Name
NMDA receptor synaptonuclear signaling and neuronal migration factor
UniProt Gene Name
NSMF
UniProt Synonym Gene Names
NELF; Nasal embryonic LHRH factor
UniProt Entry Name
NSMF_HUMAN

NCBI Description

The protein encoded by this gene is involved in guidance of olfactory axon projections and migration of luteinizing hormone-releasing hormone neurons. Defects in this gene are a cause of idiopathic hypogonadotropic hypogonadism (IHH). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]

Uniprot Description

NSMF: Couples NMDA receptor signaling to the nucleus. Influences outgrowth of olfactory axons and migration of LHRH neurons. Defects in NELF may be associated with idiopathic hypogonadotropic hypogonadism (IHH). IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cortical cytoskeleton; nuclear membrane; neuron projection; nuclear matrix; postsynaptic density; dendrite; nuclear envelope; perikaryon; nucleoplasm; postsynaptic membrane; membrane; cytoplasm; synapse; nucleus; cell junction

Molecular Function: calcium-dependent protein binding

Biological Process: regulation of dendrite morphogenesis; regulation of neuron apoptosis; positive regulation of protein amino acid dephosphorylation; regulation of neuronal synaptic plasticity

Disease: Hypogonadotropic Hypogonadism 9 With Or Without Anosmia

Research Articles on NSMF

Similar Products

Product Notes

The NSMF nsmf (Catalog #AAA3220041) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSMF Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NSMF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSMF nsmf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQSHPENRNG ADHLLADAYS GHDGSPEMQP APQNKRRLSL VSNGCYEGSL. It is sometimes possible for the material contained within the vial of "NSMF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.