Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR5A2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit NR5A2 Polyclonal Antibody | anti-NR5A2 antibody

NR5A2 antibody - N-terminal region

Gene Names
NR5A2; B1F; CPF; FTF; B1F2; LRH1; LRH-1; FTZ-F1; hB1F-2; FTZ-F1beta
Reactivity
Cow, Guinea Pig, Human, Pig, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
NR5A2; Polyclonal Antibody; NR5A2 antibody - N-terminal region; anti-NR5A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY
Sequence Length
541
Applicable Applications for anti-NR5A2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 86%; Human: 100%; Pig: 92%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR5A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR5A2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NR5A2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NR5A2 antibody
This is a rabbit polyclonal antibody against NR5A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR5A2 binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
nuclear receptor subfamily 5 group A member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 5 group A member 2
NCBI Official Symbol
NR5A2
NCBI Official Synonym Symbols
B1F; CPF; FTF; B1F2; LRH1; LRH-1; FTZ-F1; hB1F-2; FTZ-F1beta
NCBI Protein Information
nuclear receptor subfamily 5 group A member 2
UniProt Protein Name
Nuclear receptor subfamily 5 group A member 2
UniProt Gene Name
NR5A2
UniProt Synonym Gene Names
B1F; CPF; FTF; hB1F; LRH-1
UniProt Entry Name
NR5A2_HUMAN

NCBI Description

The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development. [provided by RefSeq, Jun 2016]

Uniprot Description

NR5A2: Binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. May be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. May also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. Belongs to the nuclear hormone receptor family. NR5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: chromatin binding; DNA binding; ligand-dependent nuclear receptor activity; phospholipid binding; protein binding; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription factor activity; zinc ion binding

Biological Process: bile acid metabolic process; cholesterol homeostasis; embryonic development; epithelial cell differentiation; homeostatic process; hormone-mediated signaling; intracellular receptor-mediated signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of viral genome replication; regulation of cell proliferation; regulation of transcription, DNA-dependent; steroid hormone mediated signaling; tissue development; transcription initiation from RNA polymerase II promoter

Research Articles on NR5A2

Similar Products

Product Notes

The NR5A2 nr5a2 (Catalog #AAA3204052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR5A2 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's NR5A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR5A2 nr5a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSNSDTGDL QESLKHGLTP IVSQFKMVNY SYDEDLEELC PVCGDKVSGY. It is sometimes possible for the material contained within the vial of "NR5A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.