Western Blot (WB)
(Host: RabbitTarget Name: NR5A1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse NR5A1 Polyclonal Antibody | anti-NR5A1 antibody
NR5A1 Antibody-middlel region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR5A1; Polyclonal Antibody; NR5A1 Antibody-middlel region; steroidogenic factor 1; ELP; SF1; SF-1; Ad4BP; ELP-3; Ftzf1; STF-1; Ftz-F1; anti-NR5A1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
SCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDR
Applicable Applications for anti-NR5A1 antibody
Western Blot (WB)
Protein Size
462 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse NR5A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NR5A1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NR5A1Sample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NR5A1 antibody
Description of Target: Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity (By similarity). Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl(3,4)bisphosphate, phosphatidyl(3,5)bisphosphate and phosphatidyl(3,4,5)triphosphate. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
UniProt Protein Name
Steroidogenic factor 1
Protein Family
UniProt Gene Name
Nr5a1
UniProt Synonym Gene Names
Ftzf1; SF-1; STF-1; ELP
UniProt Entry Name
STF1_MOUSE
Similar Products
Product Notes
The NR5A1 nr5a1 (Catalog #AAA3249713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR5A1 Antibody-middlel region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NR5A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR5A1 nr5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SCKIDKTQRK RCPFCRFQKC LTVGMRLEAV RADRMRGGRN KFGPMYKRDR. It is sometimes possible for the material contained within the vial of "NR5A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
