Western Blot (WB)
(Host: RabbitTarget Name: NR1H2Sample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Rabbit NR1H2 Polyclonal Antibody | anti-NR1H2 antibody
NR1H2 antibody - N-terminal region
Gene Names
NR1H2; NER; UNR; LXRB; LXR-b; NER-I; RIP15
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
NR1H2; Polyclonal Antibody; NR1H2 antibody - N-terminal region; anti-NR1H2 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
Sequence Length
460
Applicable Applications for anti-NR1H2 antibody
Western Blot (WB)
Homology
Dog: 90%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1H2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NR1H2Sample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NR1H2Sample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-NR1H2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-NR1H2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-NR1H2 antibody
This is a rabbit polyclonal antibody against NR1H2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Target Description: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Product Categories/Family for anti-NR1H2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa
NCBI Official Full Name
oxysterols receptor LXR-beta isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1 group H member 2
NCBI Official Symbol
NR1H2
NCBI Official Synonym Symbols
NER; UNR; LXRB; LXR-b; NER-I; RIP15
NCBI Protein Information
oxysterols receptor LXR-beta
Protein Family
NCBI Description
The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010]
Research Articles on NR1H2
Similar Products
Product Notes
The NR1H2 (Catalog #AAA3204335) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1H2 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NR1H2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR1H2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNGPPQPGAP SSSPTVKEEG PEPWPGGPDP DVPGTDEASS ACSTDWVIPD. It is sometimes possible for the material contained within the vial of "NR1H2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
