Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR1H2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Rabbit NR1H2 Polyclonal Antibody | anti-NR1H2 antibody

NR1H2 antibody - middle region

Gene Names
NR1H2; NER; UNR; LXRB; LXR-b; NER-I; RIP15
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR1H2; Polyclonal Antibody; NR1H2 antibody - middle region; anti-NR1H2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL
Sequence Length
461
Applicable Applications for anti-NR1H2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NR1H2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR1H2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-NR1H2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Related Product Information for anti-NR1H2 antibody
This is a rabbit polyclonal antibody against NR1H2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR1H2 is an orphan receptor. NR1H2 binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4).The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995 [PubMed 7625741]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
oxysterols receptor LXR-beta isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1 group H member 2
NCBI Official Symbol
NR1H2
NCBI Official Synonym Symbols
NER; UNR; LXRB; LXR-b; NER-I; RIP15
NCBI Protein Information
oxysterols receptor LXR-beta
UniProt Protein Name
Oxysterols receptor LXR-beta
Protein Family
UniProt Gene Name
NR1H2
UniProt Synonym Gene Names
LXRB; NER; UNR
UniProt Entry Name
NR1H2_HUMAN

NCBI Description

The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010]

Uniprot Description

LXR-beta: Orphan receptor. Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8. Forms a heterodimer with RXR. Ubiquitous. Belongs to the nuclear hormone receptor family. NR1 subfamily.

Protein type: Nuclear receptor

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: retinoid X receptor binding; ligand-dependent nuclear receptor activity; protein binding; DNA binding; zinc ion binding; steroid hormone receptor activity; apolipoprotein A-I receptor binding; ATPase binding

Biological Process: negative regulation of lipid transport; negative regulation of proteolysis; retinoic acid receptor signaling pathway; positive regulation of fatty acid biosynthetic process; transcription initiation from RNA polymerase II promoter; positive regulation of cellular protein metabolic process; cellular lipid metabolic process; negative regulation of pinocytosis; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cholesterol transport; cholesterol homeostasis; positive regulation of lipoprotein lipase activity; gene expression; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on NR1H2

Similar Products

Product Notes

The NR1H2 nr1h2 (Catalog #AAA3201548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1H2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NR1H2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR1H2 nr1h2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETECITFLKD FTYSKDDFHR AGLQVEFINP IFEFSRAMRR LGLDDAEYAL. It is sometimes possible for the material contained within the vial of "NR1H2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.