Western Blot (WB)
(Host: RabbitTarget Name: Nploc4Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Nploc4 Polyclonal Antibody | anti-NPLOC4 antibody
Nploc4 Antibody - N-terminal region
Gene Names
Nploc4; Npl4; AK129375; mKIAA1499
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nploc4; Polyclonal Antibody; Nploc4 Antibody - N-terminal region; anti-NPLOC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLKAFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLE
Sequence Length
608
Applicable Applications for anti-NPLOC4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Nploc4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Nploc4Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Nploc4Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NPLOC4 antibody
This is a rabbit polyclonal antibody against Nploc4. It was validated on Western Blot
Target Description: The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope.
Target Description: The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope.
Product Categories/Family for anti-NPLOC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
nuclear protein localization protein 4 homolog isoform A
NCBI Official Synonym Full Names
NPL4 homolog, ubiquitin recognition factor
NCBI Official Symbol
Nploc4
NCBI Official Synonym Symbols
Npl4; AK129375; mKIAA1499
NCBI Protein Information
nuclear protein localization protein 4 homolog
UniProt Protein Name
Nuclear protein localization protein 4 homolog
Protein Family
UniProt Gene Name
Nploc4
UniProt Synonym Gene Names
Kiaa1499; Npl4; Protein NPL4
UniProt Entry Name
NPL4_MOUSE
Research Articles on NPLOC4
Similar Products
Product Notes
The NPLOC4 nploc4 (Catalog #AAA3215575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nploc4 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Nploc4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPLOC4 nploc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLKAFGAPNV VEDEIDQYLS KQDGKIYRSR DPQLCRHGPL GKCVHCVPLE. It is sometimes possible for the material contained within the vial of "Nploc4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
