Western Blot (WB)
(NPC2 polyclonal antibody. Western Blot analysis of NPC2 expression in NIH/3T3.)
Mouse anti-Human, Mouse NPC2 Polyclonal Antibody | anti-npc2 antibody
NPC2 (Epididymal Secretory Protein E1, Human Epididymis-specific Protein 1, He1, Niemann-Pick Disease Type C2 Protein, HE1)
Gene Names
npc2; cb292; sb:cb292
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
NPC2; Polyclonal Antibody; NPC2 (Epididymal Secretory Protein E1; Human Epididymis-specific Protein 1; He1; Niemann-Pick Disease Type C2 Protein; HE1); Anti -NPC2 (Epididymal Secretory Protein E1; anti-npc2 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NPC2. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Applicable Applications for anti-npc2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human NPC2, aa1-151 (NP_006423.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(NPC2 polyclonal antibody. Western Blot analysis of NPC2 expression in NIH/3T3.)
Western Blot (WB)
(NPC2 polyclonal antibody. Western Blot analysis of NPC2 expression in NIH/3T3.)
Western Blot (WB)
(NPC2 polyclonal antibody. Western Blot analysis of NPC2 expression in NIH/3T3.)
Western Blot (WB)
(NPC2 polyclonal antibody. Western Blot analysis of NPC2 expression in NIH/3T3.)
Related Product Information for anti-npc2 antibody
May be involved in the regulation of the lipid composition of sperm membranes during the maturation in the epididymis.
Product Categories/Family for anti-npc2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16,306 Da
NCBI Official Full Name
Npc2 protein
NCBI Official Synonym Full Names
Niemann-Pick disease, type C2
NCBI Official Symbol
npc2
NCBI Official Synonym Symbols
cb292; sb:cb292
NCBI Protein Information
epididymal secretory protein E1; 16.5 kDa secretory protein; niemann Pick type C2 protein homolog
UniProt Protein Name
Epididymal secretory protein E1
Protein Family
UniProt Gene Name
npc2
UniProt Entry Name
NPC2_DANRE
Uniprot Description
Function: Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment
By similarity.
Subunit structure: Interacts with NUS1/NgBR, the interaction stabilizes NCP2 and regulates cholesterol trafficking. Interacts with DHDDS
By similarity.
Subcellular location: Secreted. Endoplasmic reticulum
By similarity.
Sequence similarities: Belongs to the NPC2 family.
Similar Products
Product Notes
The npc2 npc2 (Catalog #AAA6013507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NPC2 (Epididymal Secretory Protein E1, Human Epididymis-specific Protein 1, He1, Niemann-Pick Disease Type C2 Protein, HE1) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NPC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the npc2 npc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRFLAATFLL LALSTAAQAE PVQFKDCGSV DGVIKEVNVS PCPTQPCQLS KGQSYSVNVT FTSNIQSKSS KAVVHGILMG VPVPFPIPEP DGCKSGINCP IQKDKTYSYL NKLPVKSEYP SIKLVVEWQL QDDKNQSLFC WEIPVQIVSH L. It is sometimes possible for the material contained within the vial of "NPC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
