Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NPBWR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit anti-Human NPBWR1 Polyclonal Antibody | anti-NPBWR1 antibody

NPBWR1 Antibody - N-terminal region

Gene Names
NPBWR1; GPR7
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPBWR1; Polyclonal Antibody; NPBWR1 Antibody - N-terminal region; anti-NPBWR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN
Sequence Length
328
Applicable Applications for anti-NPBWR1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPBWR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NPBWR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-NPBWR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-NPBWR1 antibody
This is a rabbit polyclonal antibody against NPBWR1. It was validated on Western Blot

Target Description: NPBWR1 interacts specifically with a number of opioid ligands. NPBWR1 is a receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. NPBWR1 has a higher affinity for neuropeptide B.
Product Categories/Family for anti-NPBWR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
neuropeptides B/W receptor type 1
NCBI Official Synonym Full Names
neuropeptides B and W receptor 1
NCBI Official Symbol
NPBWR1
NCBI Official Synonym Symbols
GPR7
NCBI Protein Information
neuropeptides B/W receptor type 1
UniProt Protein Name
Neuropeptides B/W receptor type 1
UniProt Gene Name
NPBWR1
UniProt Synonym Gene Names
GPR7
UniProt Entry Name
NPBW1_HUMAN

Uniprot Description

NPBWR1: Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. Has a higher affinity for neuropeptide B. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 8p22-q21.13

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: neuropeptide binding; protein binding; neuropeptide receptor activity; opioid receptor activity

Biological Process: synaptic transmission; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; neuropeptide signaling pathway; regulation of metabolic process

Research Articles on NPBWR1

Similar Products

Product Notes

The NPBWR1 npbwr1 (Catalog #AAA3216574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPBWR1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPBWR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPBWR1 npbwr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSEPWPANAS GPDPALSCSN ASTLAPLPAP LAVAVPVVYA VICAVGLAGN. It is sometimes possible for the material contained within the vial of "NPBWR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.