Western Blot (WB)
(WB Suggested Anti-GPR160 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Rabbit anti-Horse, Human GPR160 Polyclonal Antibody | anti-GPR160 antibody
GPR160 Antibody - C-terminal region
Gene Names
GPR160; GPCR1; GPCR150
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR160; Polyclonal Antibody; GPR160 Antibody - C-terminal region; anti-GPR160 antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM
Sequence Length
338
Applicable Applications for anti-GPR160 antibody
Western Blot (WB)
Homology
Horse: 92%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR160
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GPR160 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Western Blot (WB)
(WB Suggested Anti-GPR160 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Related Product Information for anti-GPR160 antibody
This is a rabbit polyclonal antibody against GPR160. It was validated on Western Blot
Target Description: GPR160 is an orphan receptor.
Target Description: GPR160 is an orphan receptor.
Product Categories/Family for anti-GPR160 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
probable G-protein coupled receptor 160
NCBI Official Synonym Full Names
G protein-coupled receptor 160
NCBI Official Symbol
GPR160
NCBI Official Synonym Symbols
GPCR1; GPCR150
NCBI Protein Information
probable G-protein coupled receptor 160
UniProt Protein Name
Probable G-protein coupled receptor 160
Protein Family
UniProt Gene Name
GPR160
UniProt Synonym Gene Names
GPCR150; hGPCR1
UniProt Entry Name
GP160_HUMAN
Uniprot Description
GPR160: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 3q26.2-q27
Cellular Component: integral to membrane; plasma membrane; receptor complex
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on GPR160
Similar Products
Product Notes
The GPR160 gpr160 (Catalog #AAA3217022) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR160 Antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR160 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR160 gpr160 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSSHSSYTVR SKKIFLSKLI VCFLSTWLPF VLLQVIIVLL KVQIPAYIEM. It is sometimes possible for the material contained within the vial of "GPR160, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
