Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOXO1Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)

Rabbit NOXO1 Polyclonal Antibody | anti-NOXO1 antibody

NOXO1 antibody - middle region

Gene Names
NOXO1; SNX28; P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NOXO1; Polyclonal Antibody; NOXO1 antibody - middle region; anti-NOXO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR
Sequence Length
376
Applicable Applications for anti-NOXO1 antibody
Western Blot (WB)
Homology
Cow: 77%; Horse: 77%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOXO1Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)

Western Blot (WB) (Host: RabbitTarget Name: NOXO1Antibody Dilution: 1.0ug/mlSample Type: Human Kidney)
Related Product Information for anti-NOXO1 antibody
This is a rabbit polyclonal antibody against NOXO1. It was validated on Western Blot

Target Description: NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators to NOX and also target NOX to different subcellular compartments.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
NADPH oxidase organizer 1 isoform c
NCBI Official Synonym Full Names
NADPH oxidase organizer 1
NCBI Official Symbol
NOXO1
NCBI Official Synonym Symbols
SNX28; P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5
NCBI Protein Information
NADPH oxidase organizer 1
UniProt Protein Name
NADPH oxidase organizer 1
Protein Family
UniProt Gene Name
NOXO1
UniProt Synonym Gene Names
P41NOX; SH3PXD5
UniProt Entry Name
NOXO1_HUMAN

NCBI Description

This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012]

Uniprot Description

NOXO1: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: NADPH oxidase complex

Molecular Function: identical protein binding; protein binding; enzyme binding; superoxide-generating NADPH oxidase activator activity; phospholipid binding; phosphoinositide binding

Biological Process: positive regulation of catalytic activity; extracellular matrix disassembly; superoxide metabolic process; regulation of hydrogen peroxide metabolic process

Research Articles on NOXO1

Similar Products

Product Notes

The NOXO1 noxo1 (Catalog #AAA3216259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOXO1 antibody - middle region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOXO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOXO1 noxo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HSLEAQSLRC LQPFCTQDTR DRPFQAQAQE SLDVLLRHPS GWWLVENEDR. It is sometimes possible for the material contained within the vial of "NOXO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.