Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NOV rabbit polyclonal antibody. Western Blot analysis of NOV expression in HeLa.)

Rabbit anti-Human NOV Polyclonal Antibody | anti-NOV antibody

NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Protein 9, IGFBP-9, IBP-9, Nephroblastoma Overexpressed Gene Protein Homolog, CCN Family Member 3, NOVH, IGFBP9, CCN3) (HRP)

Gene Names
CCN3; NOV; NOVh; IBP-9; IGFBP9; IGFBP-9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NOV; Polyclonal Antibody; NOV (Protein NOV Homolog; NovH; Insulin-like Growth Factor-binding Protein 9; IGF-binding Protein 9; IGFBP-9; IBP-9; Nephroblastoma Overexpressed Gene Protein Homolog; CCN Family Member 3; NOVH; IGFBP9; CCN3) (HRP); anti-NOV antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NOV.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
2377
Applicable Applications for anti-NOV antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NOV, aa1-357 (AAH15028.1).
Immunogen Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NOV rabbit polyclonal antibody. Western Blot analysis of NOV expression in HeLa.)

Western Blot (WB) (NOV rabbit polyclonal antibody. Western Blot analysis of NOV expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NOV expression in transfected 293T cell line by NOV polyclonal antibody. Lane 1: NOV transfected lysate (39.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NOV expression in transfected 293T cell line by NOV polyclonal antibody. Lane 1: NOV transfected lysate (39.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NOV antibody
NOV is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Product Categories/Family for anti-NOV antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens nephroblastoma overexpressed gene, mRNA
NCBI Official Synonym Full Names
cellular communication network factor 3
NCBI Official Symbol
CCN3
NCBI Official Synonym Symbols
NOV; NOVh; IBP-9; IGFBP9; IGFBP-9
NCBI Protein Information
CCN family member 3
Protein Family

NCBI Description

The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq, Feb 2009]

Research Articles on NOV

Similar Products

Product Notes

The NOV (Catalog #AAA6387275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Protein 9, IGFBP-9, IBP-9, Nephroblastoma Overexpressed Gene Protein Homolog, CCN Family Member 3, NOVH, IGFBP9, CCN3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOV can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOV for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.