Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NOV Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)

Rabbit NOV Polyclonal Antibody | anti-NOV antibody

NOV antibody - C-terminal region

Gene Names
CCN3; NOV; NOVh; IBP-9; IGFBP9; IGFBP-9
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
NOV; Polyclonal Antibody; NOV antibody - C-terminal region; anti-NOV antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
Sequence Length
357
Applicable Applications for anti-NOV antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NOV
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NOV Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-NOV Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-NOV antibody
This is a rabbit polyclonal antibody against NOV. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
Product Categories/Family for anti-NOV antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
CCN family member 3
NCBI Official Synonym Full Names
cellular communication network factor 3
NCBI Official Symbol
CCN3
NCBI Official Synonym Symbols
NOV; NOVh; IBP-9; IGFBP9; IGFBP-9
NCBI Protein Information
CCN family member 3
UniProt Protein Name
Protein NOV homolog
Protein Family
UniProt Gene Name
NOV
UniProt Synonym Gene Names
CCN3; IGFBP9; NOVH; NovH; IBP-9; IGF-binding protein 9; IGFBP-9
UniProt Entry Name
NOV_HUMAN

NCBI Description

The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq, Feb 2009]

Uniprot Description

NOV: Immediate-early protein likely to play a role in cell growth regulation. Belongs to the CCN family. Expression is down-regulated by WT1. Interacts with FBLN1.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.1

Cellular Component: proteinaceous extracellular matrix; intracellular membrane-bound organelle; cell soma; axon; dendrite

Molecular Function: heparin binding; integrin binding; insulin-like growth factor binding; growth factor activity

Biological Process: cell-cell signaling; regulation of gene expression; regulation of cell growth; cell adhesion; signal transduction

Research Articles on NOV

Similar Products

Product Notes

The NOV nov (Catalog #AAA3206960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOV antibody - C-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NOV can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOV nov for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTIQAEFQCS PGQIVKKPVM VIGTCTCHTN CPKNNEAFLQ ELELKTTRGK. It is sometimes possible for the material contained within the vial of "NOV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.