Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOP14Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NOP14 Polyclonal Antibody | anti-NOP14 antibody

NOP14 Antibody - N-terminal region

Gene Names
NOP14; UTP2; NOL14; C4orf9; RES425; RES4-25
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NOP14; Polyclonal Antibody; NOP14 Antibody - N-terminal region; anti-NOP14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSN
Sequence Length
857
Applicable Applications for anti-NOP14 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NOP14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOP14Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOP14Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NOP14 antibody
This gene encodes a protein that plays a role in pre-18s rRNA processing and small ribosomal subunit assembly. The encoded protein may be involved in the regulation of pancreatic cancer cell proliferation and migration. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-NOP14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98 kDa
NCBI Official Full Name
nucleolar protein 14 isoform 1
NCBI Official Synonym Full Names
NOP14 nucleolar protein
NCBI Official Symbol
NOP14
NCBI Official Synonym Symbols
UTP2; NOL14; C4orf9; RES425; RES4-25
NCBI Protein Information
nucleolar protein 14
UniProt Protein Name
Nucleolar protein 14
Protein Family
UniProt Gene Name
NOP14
UniProt Synonym Gene Names
C4orf9; NOL14
UniProt Entry Name
NOP14_HUMAN

NCBI Description

This gene encodes a protein that plays a role in pre-18s rRNA processing and small ribosomal subunit assembly. The encoded protein may be involved in the regulation of pancreatic cancer cell proliferation and migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

NOP14: Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm. Belongs to the NOP14 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: small subunit processome; mitochondrion; membrane; nucleolus; nucleus

Molecular Function: snoRNA binding; enzyme binding

Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); ribosomal small subunit biogenesis and assembly; endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA); endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); rRNA processing; maturation of SSU-rRNA

Research Articles on NOP14

Similar Products

Product Notes

The NOP14 nop14 (Catalog #AAA3219960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOP14 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOP14 nop14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDQDWKEIQT LLSHKTPKSE NRDKKEKPKP DAYDMMVREL GFEMKAQPSN. It is sometimes possible for the material contained within the vial of "NOP14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.