Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type : subnuclear bodies-paraspeckles)

Rabbit NONO Polyclonal Antibody | anti-NONO antibody

NONO antibody - C-terminal region

Gene Names
NONO; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
Reactivity
Tested Species Reactivity: Human (Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Applications
Immunofluorescence, Immunohistochemistry, Western Blot, Immunoprecipitation
Purity
Protein A purified
Synonyms
NONO; Polyclonal Antibody; NONO antibody - C-terminal region; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114; anti-NONO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human (Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Applicable Applications for anti-NONO antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB), Immunoprecipitation (IP)
Protein Size (# AA)
471 amino acids
Protein Interactions
SFPQ; PTBP1; PRKAA2; PIN1; NONO; FUS; DDX6; C11orf68; PSPC1; HUWE1; LMO4; UBC; SUMO2; STAU1; MDM2; RPA3; RPA2; RPA1; ASB18; WWOX; ASB3; ERG; EED; rev; WBP4; TCERG1; APBB1; PRPF40A; LMNA; CD81; PAN2; CTNNB1; ORC5; MYC; ITGA4; IL7R; FN1; EWSR1; YLPM1; RNF43
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
Protein Name
Non-POU domain-containing octamer-binding protein
Replacement Item
This antibody may replace item sc-23247 from Santa Cruz Biotechnology.
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type : subnuclear bodies-paraspeckles)

Immunofluorescence (IF) (Sample Type : subnuclear bodies-paraspeckles)

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Human Liver )

Immunohistochemistry (IHC) (Human Liver )

Immunohistochemistry (IHC)

(Rabbit Anti-NONO AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NONO AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-NONO AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NONO AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-NONO Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NONO Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Immunohistochemistry (IHC)

(Rabbit Anti-NONO Antibody Catalog Number: MBS3205431 Paraffin Embedded Tissue: Human cardiac cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NONO Antibody Catalog Number: MBS3205431 Paraffin Embedded Tissue: Human cardiac cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-NONO Antibody Catalog Number: MBS3205431 Paraffin Embedded Tissue: Human cardiac cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NONO Antibody Catalog Number: MBS3205431 Paraffin Embedded Tissue: Human cardiac cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)
Related Product Information for anti-NONO antibody
NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
non-POU domain-containing octamer-binding protein isoform 1
NCBI Official Synonym Full Names
non-POU domain containing octamer binding
NCBI Official Symbol
NONO
NCBI Official Synonym Symbols
P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
NCBI Protein Information
non-POU domain-containing octamer-binding protein
UniProt Protein Name
Non-POU domain-containing octamer-binding protein
UniProt Gene Name
NONO
UniProt Synonym Gene Names
NRB54; NonO protein; p54nrb
UniProt Entry Name
NONO_HUMAN

NCBI Description

This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009]

Uniprot Description

NONO: DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Together with PSPC1, required for the formation of nuclear paraspeckles. A chromosomal aberration involving NONO may be a cause of papillary renal cell carcinoma (PRCC). Translocation t(X;X)(p11.2;q13.1) with TFE3.

Protein type: Nuclear receptor co-regulator; RNA-binding; Nucleolus; RNA splicing

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: membrane; nuclear matrix; nuclear speck; nucleolus; nucleoplasm; nucleus; paraspeckles

Molecular Function: chromatin binding; identical protein binding; nucleotide binding; protein binding

Biological Process: circadian rhythm; DNA recombination; DNA repair; mRNA processing; negative regulation of transcription, DNA-dependent; nuclear mRNA splicing, via spliceosome; regulation of circadian rhythm; regulation of transcription, DNA-dependent; RNA splicing; transcription, DNA-dependent

Research Articles on NONO

Similar Products

Product Notes

The NONO nono (Catalog #AAA3205431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NONO antibody - C-terminal region reacts with Tested Species Reactivity: Human (Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's NONO can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the NONO nono for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGTLGLTPPT TERFGQAATM EGIGAIGGTP PAFNRAAPGA EFAPNKRRRY. It is sometimes possible for the material contained within the vial of "NONO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.