Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NOL10 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Rabbit anti-Human, Mouse NOL10 Polyclonal Antibody | anti-NOL10 antibody
NOL10 Rabbit pAb
Gene Names
NOL10; PQBP5
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
NOL10; Polyclonal Antibody; NOL10 Rabbit pAb; PQBP5; anti-NOL10 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMH
Applicable Applications for anti-NOL10 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human NOL10 (NP_079170.2).
Positive Samples
HT-29, Mouse thymus, Mouse testis, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NOL10 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NOL10 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Product Categories/Family for anti-NOL10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
80,302 Da
NCBI Official Full Name
nucleolar protein 10 isoform 2
NCBI Official Synonym Full Names
nucleolar protein 10
NCBI Official Symbol
NOL10
NCBI Official Synonym Symbols
PQBP5
NCBI Protein Information
nucleolar protein 10; H_NH0074G24.1; polyglutamine binding protein 5
UniProt Protein Name
Nucleolar protein 10
Protein Family
UniProt Gene Name
NOL10
UniProt Entry Name
NOL10_HUMAN
Uniprot Description
NOL10: Belongs to the WD repeat NOL10/ENP2 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding; Nucleolus
Chromosomal Location of Human Ortholog: 2p25.1
Cellular Component: nucleolus
Similar Products
Product Notes
The NOL10 nol10 (Catalog #AAA9143008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOL10 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NOL10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NOL10 nol10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KNSGKIFTSL EPEHDLNDVC LYPNSGMLLT ANETPKMGIY YIPVLGPAPR WCSFLDNLTE ELEENPESTV YDDYKFVTKK DLENLGLTHL IGSPFLRAYM H. It is sometimes possible for the material contained within the vial of "NOL10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
