Western Blot (WB)
(NMI rabbit polyclonal antibody. Western Blot analysis of NMI expression in human liver.)
Rabbit anti-Human NMI Polyclonal Antibody | anti-NMI antibody
NMI (N-myc-interactor, Nmi, N-myc and STAT Interactor) (PE)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NMI; Polyclonal Antibody; NMI (N-myc-interactor; Nmi; N-myc and STAT Interactor) (PE); anti-NMI antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NMI.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1180
Applicable Applications for anti-NMI antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NMI, aa1-307 (AAH21987.1).
Immunogen Sequence
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(NMI rabbit polyclonal antibody. Western Blot analysis of NMI expression in human liver.)
Western Blot (WB)
(NMI rabbit polyclonal antibody. Western Blot analysis of NMI expression in human liver.)
Western Blot (WB)
(NMI rabbit polyclonal antibody. Western Blot analysis of NMI expression in A-431.)
Western Blot (WB)
(NMI rabbit polyclonal antibody. Western Blot analysis of NMI expression in A-431.)
Western Blot (WB)
(Western Blot analysis of NMI expression in transfected 293T cell line by NMI polyclonal antibody. Lane 1: NMI transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of NMI expression in transfected 293T cell line by NMI polyclonal antibody. Lane 1: NMI transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NMI antibody
May be involved in augmenting coactivator protein recruitment to a group of sequence-specific transcription factors. Augments cytokine-mediated STAT transcription. Enhances CBP/p300 coactivator protein recruitment to STAT1 and STAT5.
Product Categories/Family for anti-NMI antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens N-myc (and STAT) interactor, mRNA
NCBI Official Synonym Full Names
N-myc and STAT interactor
NCBI Official Symbol
NMI
NCBI Protein Information
N-myc-interactor
Protein Family
NCBI Description
NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
Research Articles on NMI
Similar Products
Product Notes
The NMI (Catalog #AAA6387182) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMI (N-myc-interactor, Nmi, N-myc and STAT Interactor) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NMI for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NMI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
