Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-NKX2-5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Nkx2-5 Polyclonal Antibody | anti-NKX2-5 antibody

Nkx2-5 antibody - N-terminal region

Gene Names
NKX2-5; CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nkx2-5; Polyclonal Antibody; Nkx2-5 antibody - N-terminal region; anti-NKX2-5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE
Sequence Length
324
Applicable Applications for anti-NKX2-5 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 77%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human Nkx2-5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NKX2-5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-NKX2-5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: NKX2-5Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: NKX2-5Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-NKX2-5 antibody
This is a rabbit polyclonal antibody against NKX2-5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1211 U34962.1 1-1211 1212-1585 BC025711.1 1143-1516

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
homeobox protein Nkx-2.5 isoform 1
NCBI Official Synonym Full Names
NK2 homeobox 5
NCBI Official Symbol
NKX2-5
NCBI Official Synonym Symbols
CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
NCBI Protein Information
homeobox protein Nkx-2.5
UniProt Protein Name
Homeobox protein Nkx-2.5
Protein Family
UniProt Gene Name
NKX2-5
UniProt Synonym Gene Names
CSX; NKX2.5; NKX2E
UniProt Entry Name
NKX25_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

NKX2-5: Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4. Interacts with HIPK1 and HIPK2, but not HIPK3. Interacts with the C-terminal zinc finger of GATA4 through its homeobox domain. Also interacts with JARID2 which represses its ability to activate transcription of ANF. Interacts with FBLIM1. Expressed only in the heart. Belongs to the NK-2 homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus; transcription factor complex

Molecular Function: chromatin binding; DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: adult heart development; atrial cardiac muscle cell development; BMP signaling pathway; cardiac muscle cell differentiation; cardiac muscle cell proliferation; cardiac muscle contraction; cardiac muscle morphogensis; cell differentiation; embryonic heart tube development; heart looping; heart morphogenesis; hemopoiesis; negative regulation of apoptosis; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; pharyngeal system development; positive regulation of cardioblast differentiation; positive regulation of cell proliferation; positive regulation of heart contraction; positive regulation of neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of cardiac muscle cell proliferation; sarcomere organization; spleen development; thyroid gland development; transcription from RNA polymerase II promoter; vasculogenesis; ventricular cardiac muscle cell development; ventricular cardiac myofibril development; Wnt receptor signaling pathway through beta-catenin

Disease: Atrial Septal Defect 7 With Or Without Atrioventricular Conduction Defects; Conotruncal Heart Malformations; Hypoplastic Left Heart Syndrome 2; Hypothyroidism, Congenital, Nongoitrous, 5; Tetralogy Of Fallot; Ventricular Septal Defect 3

Research Articles on NKX2-5

Similar Products

Product Notes

The NKX2-5 nkx2-5 (Catalog #AAA3200499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nkx2-5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Nkx2-5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NKX2-5 nkx2-5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELGRAPSPAK CASAFPAAPA FYPRAYSDPD PAKDPRAEKK ELCALQKAVE. It is sometimes possible for the material contained within the vial of "Nkx2-5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.