Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Nkx 2.5 Polyclonal Antibody | anti-NKX2.5 antibody

Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (MaxLight 650)

Gene Names
NKX2-5; CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Nkx 2.5; Polyclonal Antibody; Nkx 2.5 (Homeobox Protein Nkx-2.5; Cardiac-specific; CSX; NK-2 Homolog E; NKX2.5; NKX2E; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536) (MaxLight 650); anti-NKX2.5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NKX2-5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-NKX2.5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NKX2-5, aa1-324 (NP_004378.1).
Immunogen Sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NKX2.5 antibody
NKX2.5 is a member of the NKX homeobox transcription factor family. NKX2.5 plays an essential role in heart development and is among the earliest factors expressed in cardiac lineage of developing embryos. Its targeted disruption in mice causes abnormal heart morphogenesis, severe growth retardation, and embryonic lethality around E9.5. Defects in NKX2.5 is associated with several forms of congenital heart diseases, such as atrial defect with atrioventricular conduction defects (ASD-AVCD) and tetralogy of Fallot (TOF). Transcription activation of NKX2.5 is also associated with certain B and T cell leukemias resultant from chromosomal translocation.
Product Categories/Family for anti-NKX2.5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
homeobox protein Nkx-2.5 isoform 1
NCBI Official Synonym Full Names
NK2 homeobox 5
NCBI Official Symbol
NKX2-5
NCBI Official Synonym Symbols
CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
NCBI Protein Information
homeobox protein Nkx-2.5; tinman paralog; homeobox protein CSX; cardiac-specific homeobox 1; homeobox protein NK-2 homolog E; NK2 transcription factor related, locus 5
UniProt Protein Name
Homeobox protein Nkx-2.5
UniProt Gene Name
NKX2-5
UniProt Synonym Gene Names
CSX; NKX2.5; NKX2E
UniProt Entry Name
NKX25_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

NKX2-5: Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4. Interacts with HIPK1 and HIPK2, but not HIPK3. Interacts with the C-terminal zinc finger of GATA4 through its homeobox domain. Also interacts with JARID2 which represses its ability to activate transcription of ANF. Interacts with FBLIM1. Expressed only in the heart. Belongs to the NK-2 homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus; transcription factor complex

Molecular Function: chromatin binding; DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: adult heart development; atrial cardiac muscle cell development; BMP signaling pathway; cardiac muscle cell differentiation; cardiac muscle cell proliferation; cardiac muscle contraction; cardiac muscle morphogensis; cell differentiation; embryonic heart tube development; heart looping; heart morphogenesis; hemopoiesis; negative regulation of apoptosis; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; pharyngeal system development; positive regulation of cardioblast differentiation; positive regulation of cell proliferation; positive regulation of heart contraction; positive regulation of neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of cardiac muscle cell proliferation; sarcomere organization; spleen development; thyroid gland development; transcription from RNA polymerase II promoter; vasculogenesis; ventricular cardiac muscle cell development; ventricular cardiac myofibril development; Wnt receptor signaling pathway through beta-catenin

Disease: Atrial Septal Defect 7 With Or Without Atrioventricular Conduction Defects; Conotruncal Heart Malformations; Hypoplastic Left Heart Syndrome 2; Hypothyroidism, Congenital, Nongoitrous, 5; Tetralogy Of Fallot; Ventricular Septal Defect 3

Research Articles on NKX2.5

Similar Products

Product Notes

The NKX2.5 nkx2-5 (Catalog #AAA6387081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nkx 2.5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NKX2.5 nkx2-5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Nkx 2.5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.