NIRF Polyclonal Antibody | anti-NIRF antibody

Anti-NIRF Antibody

Cat. Num. AAA177883

• Gene Names: UHRF2; NIRF; URF2; RNF107; TDRD23
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: NIRF; Polyclonal Antibody; Anti-NIRF Antibody; E3 ubiquitin-protein ligase UHRF2; DKFZp434B0920; DKFZp686G0837; MGC33463; Np95 like RING finger protein; Np95-like ring finger protein; Np95/ICBP90 like RING finger protein; Np95/ICBP90-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; RNF 107; RP11-472F14.2; Ubiquitin like containing PHD and RING finger domains protein 2; Ubiquitin-like PHD and RING finger domain-containing protein 2; Ubiquitin-like-containing PHD and RING finger domains protein 2; Uhrf2; UHRF2_HUMAN; URF 2; ubiquitin-like with PHD and ring finger domains 2; E3 ubiquitin protein ligase; anti-NIRF antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 802

• Applicable Applications for anti-NIRF antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of NIRF expression in rat testis extract (lane 1) and K562 whole cell lysates (lane 2). NIRF at 90KD was detected using rabbit anti- NIRF Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(NIRF was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- NIRF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(NIRF was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- NIRF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(NIRF was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- NIRF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-NIRF antibody

Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

References

1. "Entrez Gene: UHRF2 ubiquitin-like, containing PHD and RING finger domains, 2". 2. Mori T, Li Y, Hata H, Ono K, Kochi H (Aug 2002). "NIRF, a novel RING finger protein, is involved in cell-cycle regulation". Biochem Biophys Res Commun 296 (3): 530-6.

NCBI and Uniprot Product Information

• NCBI GI #: 23312364
• NCBI GeneID: 115426
• NCBI Accession #: NP_690856.1
• NCBI GenBank Nucleotide #: NM_152896.2
• UniProt Accession #: Q96PU4; Q5VYR1; Q5VYR3; Q659C8; Q8TAG7
• Molecular Weight: 56,077 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase UHRF2
• NCBI Official Synonym Full Names: ubiquitin like with PHD and ring finger domains 2
• NCBI Official Symbol: UHRF2
• NCBI Official Synonym Symbols: NIRF; URF2; RNF107; TDRD23
• NCBI Protein Information: E3 ubiquitin-protein ligase UHRF2
• UniProt Protein Name: E3 ubiquitin-protein ligase UHRF2
• Protein Family: Protein
• UniProt Gene Name: UHRF2
• UniProt Synonym Gene Names: NIRF; RNF107; Np95-like RING finger protein
• UniProt Entry Name: UHRF2_HUMAN

NCBI Description

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding. [provided by RefSeq, Feb 2012]

Uniprot Description

E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. E3 SUMO-, but not ubiquitin-, protein ligase for ZNF131.