Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NGRN expression in transfected 293T cell line by NGRN polyclonal antibody. Lane 1: NGRN transfected lysate (24.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human NGRN Polyclonal Antibody | anti-NGRN antibody

NGRN (FI58G, Neugrin, Mesenchymal Stem Cell Protein DSC92, Neurite Outgrowth-associated Protein, Spinal Cord-derived Protein FI58G)

Gene Names
NGRN; DSC92
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NGRN; Polyclonal Antibody; NGRN (FI58G; Neugrin; Mesenchymal Stem Cell Protein DSC92; Neurite Outgrowth-associated Protein; Spinal Cord-derived Protein FI58G); Anti -NGRN (FI58G; anti-NGRN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NGRN.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI
Applicable Applications for anti-NGRN antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NGRN, aa1-220 (AAH01682.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NGRN expression in transfected 293T cell line by NGRN polyclonal antibody. Lane 1: NGRN transfected lysate (24.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NGRN expression in transfected 293T cell line by NGRN polyclonal antibody. Lane 1: NGRN transfected lysate (24.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NGRN antibody
NGRN may be involved in neuronal differentiation.
Product Categories/Family for anti-NGRN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32,408 Da
NCBI Official Full Name
NGRN protein, partial
NCBI Official Synonym Full Names
neugrin, neurite outgrowth associated
NCBI Official Symbol
NGRN
NCBI Official Synonym Symbols
DSC92
NCBI Protein Information
neugrin; spinal cord-derived protein FI58G; mesenchymal stem cell protein DSC92; neurite outgrowth associated protein; neurite outgrowth-associated protein
UniProt Protein Name
Neugrin
Protein Family
UniProt Gene Name
NGRN
UniProt Synonym Gene Names
FI58G
UniProt Entry Name
NGRN_HUMAN

Uniprot Description

Function: May be involved in neuronal differentiation.

Subcellular location: Nucleus. Secreted

Potential Ref.1.

Tissue specificity: Expressed at high levels in heart, brain and skeletal muscle. In brain, mainly expressed in neurons rather than glial cells. Ref.1

Induction: Highly up-regulated in neuroblastostoma cells by retinoic acid treatment inducing neurite outgrowth.

Sequence similarities: Belongs to the neugrin family.

Sequence caution: The sequence AAF65447.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence AAG09725.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence AAG09725.1 differs from that shown. Reason: Frameshift at position 47. The sequence AAH01682.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence AAH07222.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence AAH09389.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence AAH17192.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence BAB21533.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence BAB21533.1 differs from that shown. Reason: Frameshift at position 47. The sequence BAG35525.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence BAG35525.1 differs from that shown. Reason: N-terminus does not match isoform 2.The sequence CAB96088.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence CAD39160.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.

Similar Products

Product Notes

The NGRN ngrn (Catalog #AAA648533) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NGRN (FI58G, Neugrin, Mesenchymal Stem Cell Protein DSC92, Neurite Outgrowth-associated Protein, Spinal Cord-derived Protein FI58G) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NGRN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NGRN ngrn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEAPGAPPRT LTWEAMEQIR YLHEEFPESW SVPRLAEGFD VSTDVIRRVL KSKFLPTLEQ KLKQDQKVLK KAGLAHSLQH LRGSGNTSKL LPAGHSVSGS LLMPGHEASS KDPNHSTALK VIESDTHRTN TPRRRKGRNK EIQDLEESFV PVAAPLGHPR ELQKYSSDSE SPRGTGSGAL PSGQKLEELK AEEPDNFSSK VVQRGREFFD SNGNFLYRI. It is sometimes possible for the material contained within the vial of "NGRN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.