Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Liver)

Rabbit NFYA Polyclonal Antibody | anti-NFYA antibody

NFYA antibody - C-terminal region

Gene Names
NFYA; HAP2; CBF-A; CBF-B; NF-YA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NFYA; Polyclonal Antibody; NFYA antibody - C-terminal region; anti-NFYA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
Sequence Length
347
Applicable Applications for anti-NFYA antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFYA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Liver)

Immunohistochemistry (IHC) (Human Liver)

Western Blot (WB)

(WB Suggested Anti-NFYA Antibody Titration: 5.0-8.0ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNFYA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-NFYA Antibody Titration: 5.0-8.0ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNFYA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-NFYA antibody
This is a rabbit polyclonal antibody against NFYA. It was validated on Western Blot and immunohistochemistry

Target Description: NFYA is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
nuclear transcription factor Y subunit alpha isoform 1
NCBI Official Synonym Full Names
nuclear transcription factor Y subunit alpha
NCBI Official Symbol
NFYA
NCBI Official Synonym Symbols
HAP2; CBF-A; CBF-B; NF-YA
NCBI Protein Information
nuclear transcription factor Y subunit alpha
UniProt Protein Name
Nuclear transcription factor Y subunit alpha
UniProt Gene Name
NFYA
UniProt Synonym Gene Names
NF-YA
UniProt Entry Name
NFYA_HUMAN

NCBI Description

The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

NFYA: stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes. Heterotrimeric transcription factor composed of three components, NF-YA, NF-YB and NF-YC. Involved in cisplatin resistance. NF-YB and NF-YC must interact and dimerize for NF-YA association and DNA binding. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; CCAAT-binding factor complex; nucleus

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; rhythmic process; positive regulation of transcription from RNA polymerase II promoter; cellular lipid metabolic process

Research Articles on NFYA

Similar Products

Product Notes

The NFYA nfya (Catalog #AAA3200376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFYA antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NFYA can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NFYA nfya for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLHESRHRHA MARKRGEGGR FFSPKEKDSP HMQDPNQADE EAMTQIIRVS. It is sometimes possible for the material contained within the vial of "NFYA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.