Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFS1 Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateNFS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit NFS1 Polyclonal Antibody | anti-NFS1 antibody

NFS1 antibody - middle region

Gene Names
NFS1; IscS; NIFS; HUSSY-08
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
NFS1; Polyclonal Antibody; NFS1 antibody - middle region; anti-NFS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
Sequence Length
457
Applicable Applications for anti-NFS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NFS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFS1 Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateNFS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-NFS1 Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateNFS1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-NFS1 antibody
This is a rabbit polyclonal antibody against NFS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this gene supplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded protein belongs to the class-V family of pyridoxal phosphate-dependent aminotransferases. Two transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-NFS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
cysteine desulfurase, mitochondrial isoform a
NCBI Official Synonym Full Names
NFS1 cysteine desulfurase
NCBI Official Symbol
NFS1
NCBI Official Synonym Symbols
IscS; NIFS; HUSSY-08
NCBI Protein Information
cysteine desulfurase, mitochondrial
UniProt Protein Name
Cysteine desulfurase, mitochondrial
Protein Family
UniProt Gene Name
NFS1
UniProt Synonym Gene Names
NIFS
UniProt Entry Name
NFS1_HUMAN

NCBI Description

Iron-sulfur clusters are required for the function of many cellular enzymes. The proteins encoded by this gene supply inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded proteins belong to the class-V family of pyridoxal phosphate-dependent aminotransferases. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010]

Uniprot Description

NFS1: Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron- sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor. Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Mitochondrial; Cofactor and Vitamin Metabolism - thiamine; EC 2.8.1.7; Transferase

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; mitochondrion; mitochondrial matrix; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; cysteine desulfurase activity; pyridoxal phosphate binding

Biological Process: cysteine metabolic process; iron incorporation into metallo-sulfur cluster; vitamin metabolic process; sulfur amino acid metabolic process; protein complex assembly; Mo-molybdopterin cofactor biosynthetic process; molybdopterin cofactor biosynthetic process; water-soluble vitamin metabolic process

Research Articles on NFS1

Similar Products

Product Notes

The NFS1 nfs1 (Catalog #AAA3201336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFS1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NFS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFS1 nfs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTQTEHKCVL DSCRSLEAEG FQVTYLPVQK SGIIDLKELE AAIQPDTSLV. It is sometimes possible for the material contained within the vial of "NFS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.